(data stored in ACNUC7421 zone)

EMBL: CP000859.PE212

CP000859.PE212       Location/Qualifiers
FT   CDS_pept        233500..234420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0212"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components-like protein"
FT                   /note="KEGG: smr:Smar_0071 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport systems periplasmic
FT                   components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66022"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS04"
FT                   /protein_id="ABW66022.1"
FT                   /translation="MAVEFMDHAAAAFVAREKGWFTEAGLDVTAYESYATGMALAAALA
FT                   RGDIDAAFICLVPAVNSRFNAGVPVKIVAGTHKHGYGVVVNKKKIKTARDLERPDICVG
FT                   CIRQGGAVDVMLNKAVDVFHLDREAVLPKIRRMPPEKQLLALQTGQLDAVVLPEQWATM
FT                   AEAGDFEMLFTSRDVWPNMQGSVLVVKEDLIDKRPAVVRQLIAVLEQSTAWMNSHPREA
FT                   AEIVSRQLQTMGGGDGPDLGAGTRTVITPAVVERSMTRMDFTTAINPAEVQRAIDFMAR
FT                   LGYLKKAAPAAEILDLRFLEAGGGE"
     atggccgtgg agttcatgga ccatgccgcc gccgcctttg tcgcacggga aaaaggatgg        60
     tttactgagg ccggccttga cgtgacggcc tatgaaagct atgccacggg catggccctg       120
     gccgcggccc tggccagggg tgatattgac gcggctttta tttgcctggt tcccgctgtg       180
     aactcccggt tcaacgccgg ggtgcccgtc aagatcgttg ccggcacgca caagcacggt       240
     tacggggtgg tggtcaataa aaagaaaatc aaaacagcca gggatctgga gcggccggat       300
     atttgcgtgg gctgcattcg gcagggcggg gccgtggatg tgatgttgaa taaagccgtt       360
     gacgttttcc acctggacag ggaagctgtt ttgccaaaaa tacggcgcat gcccccggaa       420
     aaacagctgc tggcccttca gaccggccaa ctggacgcgg tcgtgctgcc cgagcagtgg       480
     gccaccatgg ccgaggccgg ggattttgag atgcttttta ccagccggga tgtgtggccg       540
     aacatgcagg gcagcgtgct ggtggtcaag gaggatctga ttgacaagcg acccgccgtg       600
     gtgcgacaac tgatcgccgt gctggaacaa tccaccgcct ggatgaacag tcatccccgg       660
     gaggcggccg aaatcgtgtc ccggcagctt caaactatgg gtggcggcga cggcccggac       720
     ctgggggccg gtacccgcac ggtcattacg cccgccgttg ttgagcgttc catgacccgc       780
     atggatttta ccactgccat taatcccgcc gaggtgcagc gcgccatcga ttttatggcg       840
     cgcctgggat acctgaaaaa ggcggcgccg gcggcggaaa ttttggactt gcggtttctg       900
     gaggccggag gtggagagta a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page