(data stored in ACNUC7421 zone)

EMBL: CP000859.PE215

CP000859.PE215       Location/Qualifiers
FT   CDS_pept        236378..237106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP0463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66025"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS07"
FT                   /protein_id="ABW66025.1"
FT                   /translation="MSTKLYDQIKERFASICDQYDLMDQDVTVKARTLSTEEAIGDPEA
FT                   DDFPLQQGRERLMQADFSGSLGQAFTDRFGDFKGPLREILAMPLENNYRRAIFVATINA
FT                   VMRHLGLADKTIHCRDKGPADCAAALAAFLAEEYGDIKILQVGFQPAMVEALAKRFDYR
FT                   IVDMDPDNIGTEKRGARIEGPDATADAIKWADLLLVTGTTVVNGTIEQFLTDTPVLFYG
FT                   TTIAGAAELMGWPRFCACGT"
     atgtccacaa aactttacga ccagataaaa gagcggtttg caagcatctg cgatcagtat        60
     gacctgatgg accaggacgt gacggtcaag gcccgcaccc tgtccacaga agaggccatc       120
     ggcgatcccg aggcagacga ctttcccttg cagcagggcc gggagcggct gatgcaggcc       180
     gatttttcag gctccctggg ccaggccttt accgacaggt ttggggattt taaaggcccg       240
     ttgcgcgaga ttctggccat gcccctggaa aacaactacc gccgggccat tttcgtggcc       300
     accataaacg cggtgatgcg ccacctgggc ctggccgaca aaaccattca ctgcagagac       360
     aaaggcccgg ctgactgcgc agcggccctg gccgcatttc tggcagaaga gtacggcgac       420
     ataaaaattc ttcaggtggg gtttcagccg gccatggtgg aagccctggc caaacggttt       480
     gactatcgca tcgtggacat ggacccggac aatatcggca ctgaaaagcg cggcgcccgc       540
     atcgaaggcc cggacgccac ggccgatgcc ataaagtggg ccgacctgct gctggtcacc       600
     ggcaccaccg tggtcaacgg caccatcgaa cagtttctca ccgacacgcc ggtgctcttc       660
     tacggtacca ccattgccgg cgccgccgaa ctcatgggct ggccccggtt ctgcgcctgc       720
     ggcacgtaa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page