(data stored in ACNUC7421 zone)

EMBL: CP000859.PE217

CP000859.PE217       Location/Qualifiers
FT   CDS_pept        complement(237669..238706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0217"
FT                   /product="lipid-binding START domain protein"
FT                   /note="PFAM: lipid-binding START domain protein; KEGG:
FT                   plt:Plut_0962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66027"
FT                   /db_xref="GOA:A8ZS09"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR028347"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS09"
FT                   /protein_id="ABW66027.1"
FT                   /translation="MLQKCGAAVLVLWFSLVVSAVASDPLEAGGWKRVMDKNGIKSYSR
FT                   QYQGTGIFEFKAVTVVDAPIYVVSELVRDVETYTDWMPYCSHGSSMDFINRDDKKVRIV
FT                   LDLPWPLSDREIIIHATITYDMDRGRAFFSLQNVDQWPETEARLIRVPMFSGHYTFEFI
FT                   TPDKTGVIYQYNVDLAGSLPDTLSKMIANRFLFDKLSNMQKKAVTEKYIALGEQSLDKA
FT                   LCDRILADKTRTQQIASARLAEIIQSKAVIDLMAGHMPLYDLVTTQNGIVSQKLLYAWG
FT                   SDAARKEAVKILIGAYLKSRTSDPAIVEKILSDDRLIHAIQTGSAVDNRPANVVLEAYL
FT                   NGYAG"
     atgcttcaaa aatgcggtgc ggctgttctg gttctgtggt tttctcttgt tgtctctgcc        60
     gttgcttctg atcccctgga ggccggcggc tggaaacggg tgatggacaa aaacggcata       120
     aagtcctaca gccgtcaata ccagggtacg gggatctttg aattcaaggc ggtcaccgtg       180
     gtggacgccc ccatctacgt ggtcagtgag ctggtccggg acgtggagac ctataccgac       240
     tggatgccct actgttccca tgggtcctcc atggatttta tcaaccggga cgacaaaaag       300
     gtccgcatcg ttcttgatct gccctggccc ctttccgacc gggaaatcat cattcacgcc       360
     acgataacgt acgacatgga ccgcggccgg gccttctttt ccctgcaaaa cgtggaccaa       420
     tggccggaaa ccgaggccag gctcatccgg gtgcccatgt tctcagggca ctacacgttc       480
     gagtttatca ctccggacaa aaccggggtg atctaccagt acaacgtgga cctggccggc       540
     agcctgccgg acaccctttc caaaatgatc gccaaccggt ttctctttga caagctttcc       600
     aacatgcaga aaaaggcggt aacggaaaaa tacatcgccc tgggagaaca atcgctggac       660
     aaggcgttgt gcgaccggat tctggccgac aagacccgca cgcagcagat cgcctcagcc       720
     cgcctggccg agatcattca gtcaaaagcg gtcatcgacc tcatggccgg ccacatgccg       780
     ctctacgacc tggtcaccac gcaaaacggc atcgtttcac agaaactgct ctatgcgtgg       840
     ggatctgacg ctgcccgaaa agaggcggtt aaaatcctta tcggcgccta cctgaagtcc       900
     cgcaccagcg acccggccat cgtggaaaaa atcctttcag acgaccggct gattcacgcc       960
     attcagacag gatcggccgt agacaaccgg ccggcaaacg tcgttctgga agcgtacctg      1020
     aacggctatg ccggatga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page