(data stored in ACNUC7421 zone)

EMBL: CP000859.PE22

CP000859.PE22        Location/Qualifiers
FT   CDS_pept        complement(23014..23517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65832"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR5"
FT                   /protein_id="ABW65832.1"
FT                   /translation="MASFTRSIPAGGEGTISIKVYTKHYGDQRITKTASVYTNDPSNKI
FT                   IPLTITGQVERVVSVMPNQVRLSGTVGMELKQVVRIVPGEKYPFAITEVRANQGKEIAF
FT                   DLKEITHDGRPAYQLTVTNTRKEPGTYIDFIYLKTDSQLVPNLKVRVQGTLVSPVLPNQ
FT                   EPVL"
     gtggcctcgt ttacgaggtc aatccccgcc ggcggcgagg gtaccatcag cataaaggtt        60
     tataccaaac actacgggga ccagcgcatc accaaaaccg cgtcggtcta caccaatgac       120
     ccgtccaaca aaattattcc cctgaccatc accggccagg tggagcgcgt ggtctcggtc       180
     atgcctaacc aggtacggct cagcggcacg gtgggcatgg agcttaagca ggtggtgcgc       240
     attgttcccg gtgaaaaata cccgtttgcc atcaccgaag ttcgggccaa ccagggaaag       300
     gagatcgctt ttgatctgaa agagatcacc catgatggac ggcccgccta ccagctgaca       360
     gtgaccaaca cccgcaagga gcccggcacc tatattgatt ttatctacct gaaaaccgac       420
     agccagttgg tgccgaacct gaaagtccgg gtccagggta ccctggtctc tccggttttg       480
     ccaaaccagg agccggtgct ttga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page