(data stored in ACNUC7421 zone)

EMBL: CP000859.PE224

CP000859.PE224       Location/Qualifiers
FT   CDS_pept        complement(247845..249020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0224"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: vco:VC0395_A2533 fatty oxidation complex, beta
FT                   subunit; TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66034"
FT                   /db_xref="GOA:A8ZS16"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS16"
FT                   /protein_id="ABW66034.1"
FT                   /translation="MEECVFIDGVRTPNGRAHAEKGWFRKLRPDELLTATYDALFERNK
FT                   AVKPEDIDAIMVGCANITGMQNDIGRLGWLAGGYPESVPSNTITNQCPSGMAATMHAAR
FT                   AIITGEADIMIAAGAEDMEKVPMAANMDFPPRLFSRYNLADFPMGSTAEKVAEMYKISR
FT                   EDMDNMAIWSNKKAAAARDAGKFKNEIVPIKGLDDAGNEFLVEHDQWIRDKVDPAKMAS
FT                   MKSPFKPDGNVTAATSSPLTQGACCMLMMSRKKADALGLSYTYKYSYGVLGGCDPTIMG
FT                   MAPVPAVQKLFARTGLGPQDIGAVELNEAFASQALACIRELKLDKDNAPFDKVNMWGGA
FT                   IALGHPLGESGARIIVTLLNVLKTDAPDAKYGLASLCGAFGNGGALLVEKV"
     atggaagaat gtgtatttat cgacggcgta agaaccccca acggcagggc ccatgcggaa        60
     aaaggctggt ttcggaagct gcgtcccgat gagctgctca ccgccactta cgacgccctg       120
     tttgaaagaa acaaggccgt caaacccgaa gatatcgacg ccatcatggt gggctgcgcc       180
     aatattaccg gcatgcagaa cgatatcggc cggctgggct ggctggccgg cggttatccg       240
     gagagtgttc ccagcaacac catcaccaac cagtgcccgt ccggcatggc cgccaccatg       300
     cacgcggccc gggccatcat taccggcgag gccgacatca tgatcgccgc cggtgcagaa       360
     gacatggaaa aggttcccat ggccgccaac atggactttc cgccccggct cttcagccgt       420
     tacaatctgg ccgacttccc catgggctcc accgctgaaa aggtggccga gatgtacaag       480
     atctccaggg aagacatgga caacatggcc atctggtcca acaagaaagc cgctgctgcc       540
     cgggatgccg gcaagttcaa aaacgaaatc gttccgatca agggcctgga cgacgcgggt       600
     aacgagttcc tggtagagca cgaccagtgg atccgcgaca aggtggaccc ggcaaaaatg       660
     gcaagcatga agtccccgtt caagccggac ggcaacgtga ccgccgccac ctcctccccc       720
     ctgacccagg gcgcctgctg catgctgatg atgagccgca aaaaggccga cgcgctgggc       780
     ctttcctaca catacaagta cagctacggc gtgctgggcg gctgcgaccc caccatcatg       840
     ggcatggccc cggtaccggc ggtacagaag ctgttcgccc gcaccggcct tggcccccag       900
     gacatcggcg ccgtcgagct taacgaggcc tttgccagcc aggcactggc ctgcattcgg       960
     gaactcaagc tggacaaaga caatgcgccc tttgacaagg tcaacatgtg gggcggcgcc      1020
     atcgcccttg gccatcccct gggagagtcg ggcgcccgca tcattgtcac cctcctcaat      1080
     gtcttaaaga cagatgcgcc ggatgcaaaa tacggccttg cctccctgtg cggcgccttc      1140
     ggcaacggcg gggcactgct ggtggaaaag gtctaa                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page