(data stored in ACNUC7421 zone)

EMBL: CP000859.PE228

CP000859.PE228       Location/Qualifiers
FT   CDS_pept        251955..252572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0228"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: aae:aq_281
FT                   transcriptional regulator (TetR/AcrR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66038"
FT                   /db_xref="GOA:A8ZS20"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS20"
FT                   /protein_id="ABW66038.1"
FT                   /translation="MKAEKRKDLILACSKKLFAKQGFYRTQISDIIDEARIARGTIYQY
FT                   FKNKEDIFVSLLEGAYAQWEQAVSQAVAAIDLKTIKPVDYFRLRIQTTLEFLLADPDIC
FT                   SIVLSMGFGLPEDLEKATRKLESKIRDIAVNDFMLGIHNNHVRKNINIDHAAEMIAGAA
FT                   FRSAYYMQKKAKTGDRADIDTMTDEIVNLLAPGIFLPESLKL"
     atgaaagcgg aaaaacgaaa agacctgatc ctggcatgtt cgaaaaaact gtttgcaaaa        60
     caggggtttt acaggacaca aatttcagac atcatagatg aagccaggat tgccaggggg       120
     acgatatacc agtattttaa aaacaaagaa gatatttttg tttccctgct ggaaggcgcc       180
     tatgcccagt gggagcaggc cgtttcccag gccgtggccg ccattgacct gaaaaccatc       240
     aaaccggtgg attactttcg gctgcgcata caaacaacac tggagttttt attagctgat       300
     ccggatattt gcagcattgt cctctccatg ggattcggtc ttcccgaaga cctggaaaaa       360
     gcaacccgca agcttgaaag caaaatacgg gatattgcgg taaacgactt catgctgggc       420
     attcacaaca atcatgttcg aaaaaacatc aacatcgatc atgccgccga gatgattgcc       480
     ggggccgcgt tccggtcggc ctattatatg cagaaaaagg ccaaaaccgg tgaccgggcc       540
     gacatcgaca ccatgaccga cgaaatcgtc aacctgctgg cgcccggcat ctttcttcct       600
     gaatccctga aactgtga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page