(data stored in ACNUC7421 zone)

EMBL: CP000859.PE23

CP000859.PE23        Location/Qualifiers
FT   CDS_pept        complement(23527..23751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65833"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR6"
FT                   /protein_id="ABW65833.1"
FT                   /translation="MKRLIMLSGMVLFLLSAGAVVFAADVPDKASPVAVIEARTFTFDP
FT                   VPEGTEVVHDFTVKNTGTAELRVEQVKTG"
     atgaaacgcc tgatcatgct gagcgggatg gttctgtttc tactgtcggc cggggccgtc        60
     gtctttgccg cggacgtgcc ggacaaggcg tcaccggtgg cagtgatcga agcgcgcacc       120
     ttcacctttg acccggtacc tgaaggcacc gaggtggtgc acgactttac cgtaaaaaac       180
     acgggaaccg ccgagcttcg cgtggagcag gtcaaaaccg gctga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page