(data stored in ACNUC7421 zone)

EMBL: CP000859.PE230

CP000859.PE230       Location/Qualifiers
FT   CDS_pept        complement(253885..254403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66040"
FT                   /db_xref="GOA:A8ZS22"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS22"
FT                   /protein_id="ABW66040.1"
FT                   /translation="MHDNRLQTALARLCNAWEARGLFSRHRLITVGKQMAQWRQDKNIP
FT                   GLWPRPPVLATATLDDGIGMGLDLIELYAGVAGMRIERWGLLMEPDALVEKCKTGCPDL
FT                   LGLTVLREDAMDLLDKGIAPRMPGATTILAGGPVFRMLPLSEQKEKPYVILPDLSAFVR
FT                   YVLGLNRIC"
     atgcatgata accgcctgca aacggccctt gcccggctgt gcaacgcgtg ggaggcccgg        60
     ggcctttttt cccggcaccg gctgatcacc gtgggtaaac agatggccca atggcggcag       120
     gacaaaaaca ttcccggcct gtggccccgg cccccggttc ttgccaccgc caccctggac       180
     gatggcatcg gcatgggcct tgacctgatc gagctttacg ccggtgtggc cggcatgcga       240
     atagagcggt ggggcctgct gatggagccg gatgctctgg ttgaaaagtg caaaaccggt       300
     tgtcccgacc tgctcgggct gaccgtgctg cgggaagatg ccatggacct gctggataaa       360
     gggattgcgc cgcgcatgcc gggggctacc accattctgg ccgggggccc ggttttcagg       420
     atgctgccct tgagcgaaca aaaggaaaaa ccctacgtga tcctgccgga cctctccgcc       480
     tttgtgcggt atgtgttggg tctgaaccgg atatgttga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page