(data stored in ACNUC7421 zone)

EMBL: CP000859.PE233

CP000859.PE233       Location/Qualifiers
FT   CDS_pept        256865..257626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: drm:Dred_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66043"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS25"
FT                   /protein_id="ABW66043.1"
FT                   /translation="MIIGLDKFAAHFSGYRDRYLLIGGAAVWLILEEAGIEPRATRDLD
FT                   IVLCLEALDPDFGAVFWDFIKAGGYKIQEKSTGKKNFYRFVKPSQPDYPVMLELFARRP
FT                   DALTLHDDSHLTPIPTSEEASSLSAILLDDNYYDFLHRHKRAIGGISFVSEYGLIPLKA
FT                   RAWLDLTQRKAAGENIDSRDIKKHRNDVLRLYQILSPEIKIDAPEAMRRDLDTFLRQTQ
FT                   PALSQEILKSLGVRDVNVVDVIQTIRIVYGI"
     atgatcatcg gccttgataa atttgccgcg cacttttccg gatatcggga ccggtatctg        60
     ctcattggtg gcgcggccgt gtggctgatt ctggaggagg cgggtattga gccgcgggcc       120
     accagggatc tggatattgt cctttgcctg gaagccctgg acccggattt cggggcggtt       180
     ttctgggatt ttataaaagc cgggggatac aaaattcagg aaaaaagcac gggaaagaaa       240
     aacttctacc ggtttgtgaa accttcgcaa ccggattatc cggtgatgct ggagctgttt       300
     gcccgccggc cggatgcctt gacactgcat gatgacagtc atttgacacc catccccaca       360
     agtgaagagg cttccagcct ttcggctatt ctgctggatg ataattatta tgactttctt       420
     catcgacaca agcgggcgat tggggggatt tcctttgtca gcgaatacgg ccttatacct       480
     ctcaaggccc gggcctggct ggacttgacg caaagaaaag cggccggtga aaacatcgac       540
     agccgcgata ttaaaaaaca tagaaacgat gtcttgcgtc tataccagat tctgtcgccg       600
     gagatcaaaa tagatgcgcc ggaagccatg cgccgggatc tggatacttt tctgcggcaa       660
     acccaaccgg cattgagcca ggaaatatta aagagtcttg gggtgaggga cgtgaatgtt       720
     gtcgatgtta tccagacgat cagaattgta tatggaattt aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page