(data stored in ACNUC7421 zone)

EMBL: CP000859.PE236

CP000859.PE236       Location/Qualifiers
FT   CDS_pept        259717..260922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0236"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   sfu:Sfum_0928 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66046"
FT                   /db_xref="GOA:A8ZS28"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS28"
FT                   /protein_id="ABW66046.1"
FT                   /translation="MIHRFLERSIIHINVAHFAVTVEQTLDARLRDRPVLIAPAGAART
FT                   PVYDMSQEAFASGIRKGMPVAGALKACRDCKVVPLYPARYERAMQTIAKYAGAYTPVVE
FT                   QGSGDGHLFLDVTGTSRLFGPPPDIAWRLERQIKKDFGLAPAWSVAANKLVAKVATRLV
FT                   KPVGEYIVCPGDEAPFLEPLPLGILPGVERSDLDAFAMYHIGRVNQLRPWSLAQLQVAF
FT                   DTRAQFLFDTIRGIDLSAVTSGREKEPTVAMEHEFSEDTNQRDQMEQVLYGLVEKGGRA
FT                   LRARQRFARIAGVVVDYSDGRRCARQVSIAPPTANDPALFEAARRALSLAVVRRVRVRY
FT                   IRLVLRRLLFPPVQLDLFDHDRQERQTRLLTAMDNIRSKFGDSAIYPGRMEAPGLQQLF
FT                   YA"
     atgatccacc gttttttgga acgatccatc atccatatca atgtggccca ttttgccgtg        60
     accgtggagc agacactgga cgcccgcctt cgggatcggc cggtgttaat cgcgccggcc       120
     ggggccgcgc gaacacccgt gtacgacatg agccaggagg cctttgcgtc cggcatccgc       180
     aagggcatgc cggtggccgg cgccctgaag gcctgccggg actgcaaggt ggtgccgctt       240
     tacccggccc gctatgaacg ggccatgcag accatcgcaa aatacgccgg ggcgtatacc       300
     ccggtggttg aacagggcag cggggatggc cacctgtttc tggatgtgac cgggaccagc       360
     cggctgttcg ggccgccgcc ggacatcgcc tggcgcctgg aacggcagat caaaaaagac       420
     ttcggcctgg cgccggcctg gtccgtggcc gccaataagc tggtggccaa ggtggccacc       480
     cgcctggtaa aaccggtggg cgaatatatt gtctgccccg gtgacgaggc gccctttctg       540
     gagcccctgc ccctgggtat tctgcccggg gtggagcggt ccgacctgga cgcgtttgcc       600
     atgtatcaca ttggccgggt gaaccagctg cggccgtgga gccttgcgca gttgcaggtg       660
     gcctttgata cgcgggcgca gttcctgttt gacaccattc ggggcattga tctttctgcg       720
     gtcacgtccg gccgcgaaaa ggaaccaacc gttgccatgg aacatgagtt ttccgaagac       780
     accaaccagc gggaccagat ggaacaggtg ctctacgggc ttgtggaaaa gggaggccgc       840
     gcccttcgtg cccggcagcg ctttgcccgg atcgccggtg tggtggtgga ctattcggac       900
     ggcaggcggt gcgcgcggca ggtgtccata gcgccgccta cggccaatga cccggcgctg       960
     tttgaggcgg cccgcagggc gttgtccctg gcggtggtcc gccgggtccg ggtgaggtat      1020
     atccggctgg tgctgcgcag gctgctcttt cccccggtcc agctggacct ttttgaccat      1080
     gaccggcagg aacgccagac acgccttctg accgccatgg ataacatccg gtcaaagttt      1140
     ggggacagcg ccatctaccc cggccgcatg gaggcgcctg gcctgcaaca actgttttac      1200
     gcgtga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page