(data stored in ACNUC7421 zone)

EMBL: CP000859.PE239

CP000859.PE239       Location/Qualifiers
FT   CDS_pept        complement(265545..266537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0239"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: dvl:Dvul_2599 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66049"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS31"
FT                   /protein_id="ABW66049.1"
FT                   /translation="MPRKKSDKTYGENLIWLFAELYFTGRRRSLVDLAKEMDCSKQTVI
FT                   RMVDHISRAYVPIEETKDGRKSYYHIQRPEKLPGALSMSPSEMVMLQMCLAFTRHLLGK
FT                   DLLMESERAIQKSSTLAAGATGADLFDAFLPGTIDYTPRQQDIRVLMKAMEEKTVCKIT
FT                   YKNPMESRGKTFYIKPYKLFAHNNALYLHAGMARYPGSKKTEFEFDPLLAVHRLKAVEP
FT                   TDRKFVFPKTYNFEKHFNQAFGVIKQETFQVEVSLTGYAAAFAEERRLSPDQKIEQKRD
FT                   GIVLTFTASSEPEVVSWVMSFGAEVKVLSPDWLVEEVKVAAENIRKRYQ"
     atgcccagaa aaaaatcgga caaaacctat ggagaaaacc tgatctggct gtttgccgag        60
     ctctatttta cgggaaggcg ccggtccctg gtggacctgg ccaaagagat ggattgctcc       120
     aagcagaccg tgattcgaat ggtggaccat atcagccggg cttatgtgcc gatagaggag       180
     accaaggatg gccggaaaag ctattaccat attcagcggc cggagaagct gcccggcgcg       240
     ttgagcatgt cgccgtcgga aatggtcatg cttcagatgt gcctggcctt tacgcggcac       300
     ctgctgggaa aagacctgct gatggaatcg gaaagggcca ttcagaaaag cagcaccctg       360
     gccgccggcg ccacgggcgc ggacctgttt gacgcctttc tgcccggcac catcgactac       420
     acgccccggc agcaggacat tcgcgtgctg atgaaggcca tggaagaaaa gacggtgtgc       480
     aaaatcacct ataagaaccc catggaaagc agaggcaaga ccttttacat caagccttac       540
     aagctgtttg cccacaacaa cgccctttac ctgcacgcgg gcatggcccg gtatcccggc       600
     tcaaagaaaa ccgagtttga gttcgacccg ctgctggccg tgcaccggct gaaggcggtg       660
     gaacccacgg accggaagtt tgtttttccg aaaacctaca atttcgaaaa gcatttcaac       720
     caggcctttg gcgtgatcaa gcaggagacc ttccaggtgg aggtgtcgct gaccgggtat       780
     gcggcggcct ttgcagaaga gcggcgcctg agcccggacc agaagataga gcagaaaagg       840
     gatgggattg tgctgacctt taccgcctcg tccgaaccgg aggtggtgtc gtgggtgatg       900
     tccttcggag ccgaggtaaa ggtgctttca ccggactggt tggtggagga ggtaaaggtc       960
     gcagcagaga atattcgaaa gcgttatcaa taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page