(data stored in ACNUC7421 zone)

EMBL: CP000859.PE241

CP000859.PE241       Location/Qualifiers
FT   CDS_pept        269095..270585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_3050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66051"
FT                   /db_xref="InterPro:IPR021301"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS33"
FT                   /protein_id="ABW66051.1"
FT                   /translation="MHNHTPRISKSQYLRGLQCPKSLWYYRHRPDLAPETPPGRQALFD
FT                   AGHEVGVLAQQYFKTGIEITEDYLATDKAICSTQKAVADGHIHIFEATAAAPDGAFSKI
FT                   DILKKVGKSDAWDLVEVKMSTGVKDYHVDDMALQRHAFTGAGYNIRKSILMHINNQYVR
FT                   SGDLDLLALFTLADCTEQVTSRLADVDGHVARLLDVIRQQKEPDVAPGDHCFSPFECDY
FT                   TGHCWPTHPPRSVYDLFPTGPKLNALLARDITLISEIPDDFRMTNRQQVLVQACKTGQV
FT                   QLDPAKIQKFLLSLKYPLYFLDYETINNAVPLFDRTRPYQQVPFQFSLHVQNEKNGPVN
FT                   HVEFLSTEKTDPRPAFIEKLIAHCGTKGSVIVYNKAFEKRINDELGRDFPQFKPALNRI
FT                   STRMVDLLVPFRSRHLYHPDMNGSASLKSVLPAFVPHMRYDTLEISDGGAAAQLYLSCL
FT                   KDALPAEEQQKVFDNLRVYCGQDTLAEVKLLEVMYGLV"
     atgcacaatc acaccccccg catctccaaa tcccagtacc ttcgtggcct gcagtgcccc        60
     aagtcccttt ggtattaccg ccaccgcccg gacctggccc cggaaacccc acccggccgc       120
     caggccctgt ttgacgccgg ccacgaggtg ggcgtgctgg cccaacagta ttttaaaacc       180
     ggtatcgaga tcaccgaaga ctacctggca accgacaagg ccatctgctc cacgcaaaaa       240
     gcggttgccg atggccacat tcatatcttt gaagccacgg ccgcagcccc ggatggcgcg       300
     ttctccaaaa tcgatatcct gaaaaaggtc ggcaaatccg acgcctggga cctggtcgag       360
     gtcaagatgt ccaccggcgt caaggattac cacgtagacg acatggccct tcagcgccat       420
     gcctttaccg gcgcgggcta caacattcga aaatcgatcc tcatgcacat caacaaccaa       480
     tatgtccggt ccggagacct ggaccttttg gccctgttta ccctggccga ctgtacagag       540
     caagtcacct cccggctggc cgacgttgac ggccatgtgg cccggctcct ggacgtcatc       600
     cggcaacaaa aagagccgga cgtggccccg ggcgaccact gcttttcccc ctttgaatgc       660
     gactataccg gccactgctg gcccacccat ccaccccggt cggtttacga ccttttcccc       720
     actggcccga agcttaacgc ccttctggcc cgggacatca ccctgatcag cgaaatcccc       780
     gacgattttc gcatgacaaa ccgccagcag gtgctggtcc aagcctgcaa aaccggccag       840
     gtgcagctcg acccggccaa aatccagaag tttcttttgt ctttaaaata cccgctctat       900
     tttcttgatt atgaaaccat aaacaatgcc gtgcccctgt ttgaccgcac ccggccctat       960
     cagcaggtgc cgtttcagtt ttcccttcat gttcaaaacg aaaaaaacgg cccggtcaac      1020
     cacgtggagt ttctttccac cgaaaaaaca gacccccggc cggcctttat tgaaaaactg      1080
     atcgcccact gcggcaccaa aggctcggtc atcgtttaca acaaggcttt tgaaaagcgg      1140
     atcaacgacg aactgggccg ggactttccc cagttcaaac cggccttaaa ccgcatctcc      1200
     acccgcatgg tcgacctgct ggtgcccttc cgctcccgcc acctctacca cccggacatg      1260
     aacggctcag cctcattaaa aagcgtgctc cccgcctttg tgccccacat gcgctacgac      1320
     acccttgaga tcagcgacgg cggcgccgca gcccagctct acttaagctg cctcaaagac      1380
     gctcttcccg ccgaagaaca gcagaaagtt tttgataact tgcgcgtcta ctgcgggcag      1440
     gacacccttg ccgaggtaaa gctgctggag gtaatgtacg ggctggtgta a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page