(data stored in ACNUC7421 zone)

EMBL: CP000859.PE242

CP000859.PE242       Location/Qualifiers
FT   CDS_pept        complement(270853..271938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS34"
FT                   /protein_id="ABW66052.1"
FT                   /translation="MNLFKCYTSHSKKEIKTILEVPFPVLWNDNKERRRSDVTVFDESQ
FT                   HPLLIFEVKMEDELSEDQLDDYIKYALAMNAGFILITKYPAEDWICKTLKTKMSRQYDI
FT                   VTINDLYKNLRRLKSKGLFQQEFIKYLEESCMIYNQILPQEVGLFLQSLFLRTSQQNRA
FT                   TTEKITRGIPYALEIINSNLEFLGNSVREKIEVRYKKRMVVSVLNVFEPFVTKETLEKL
FT                   LKVATKDEDHEVRVKKYSNEIYGYYWFFCSLQLNDNIKYVGLEFGYVATVEKGISRRDV
FT                   VFKNYVQLNPDPDGASYLESPHPLKYKQNKGWDAGDEIKAFDWFYKSIKVAAERYLKHY
FT                   KMNKNQKFKIACKKVEMLLDD"
     ttgaaccttt ttaaatgtta cacgtcgcat agcaaaaaag agattaaaac cattctagag        60
     gttccctttc cggttctctg gaatgataat aaagaaagaa gaagatctga tgttactgtt       120
     ttcgacgaaa gtcaacaccc acttttgata tttgaggtga aaatggaaga cgagctatca       180
     gaggatcagc tcgatgatta tattaagtat gctttagcaa tgaatgctgg ctttatattg       240
     atcacaaaat atccagccga agattggatt tgtaaaaccc tgaaaacaaa aatgagcagg       300
     caatacgata tagtgaccat aaatgattta tataaaaatt tgcgtcgcct caaaagcaaa       360
     ggactgtttc agcaggagtt tataaaatat ctggaggaga gttgcatgat atacaatcaa       420
     attttgccgc aagaggtcgg tctttttttg cagagtcttt ttctccgaac aagtcaacag       480
     aacagggcta ctacagagaa aataacaaga ggcataccat atgcgcttga gataataaat       540
     agcaatctgg agtttctagg taatagtgtt agagaaaaga tagaggtgcg atacaagaaa       600
     aggatggtcg tttcagtgtt gaatgtgttt gagccgtttg taaccaaaga aacactggaa       660
     aaattactta aagtggctac aaaagacgaa gatcatgaag ttagagtcaa aaaatatagt       720
     aatgaaatat acggctatta ttggtttttt tgttcattgc agcttaatga caatattaag       780
     tatgtcggtt tggagttcgg ctatgtggcc acggtggaaa aaggaataag ccgtagagat       840
     gttgtattta aaaattatgt gcagctgaat ccagatccag atggagcttc atatttggaa       900
     agcccgcatc ccttaaaata taaacaaaac aagggatggg acgctggaga tgagatcaag       960
     gcttttgatt ggttctataa aagcataaag gttgcggcag aaagatatct caaacattac      1020
     aaaatgaaca aaaaccagaa atttaaaatt gcttgtaaaa aagttgaaat gcttttggat      1080
     gattaa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page