(data stored in ACNUC7421 zone)

EMBL: CP000859.PE243

CP000859.PE243       Location/Qualifiers
FT   CDS_pept        complement(272158..273219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_3301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66053"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS35"
FT                   /protein_id="ABW66053.1"
FT                   /translation="MSNRKNKTTKSIEMDPSRGELLVYQGKDGDMKLEVRLYDDTIWLT
FT                   QAQMSELFATDRSVITKHLRNIFNSGELEKDAVCAKFAHTAEDGKQYQAQFYNLDAIIS
FT                   VGYRVNSIRGTQFRIWATQRLREYIVKGFALNDERLKEPEGGRYFEELLARIRDIRSSE
FT                   KVFWRKVLDIYATSIDYDPTVETSQSFFKQVQNMMHWAAHGHTAAELIYERADAARTNM
FT                   GVTNYPGNKLIKRDVEVAKNYLNEEELDLLNRIVTAYLEVAEIQALNRNPMTMADWIER
FT                   LHQFLTMTGRDLLSHAGKISHEEALRKAHEEYEKFRVRQLAEPTEAEKHFVEAEKKLNQ
FT                   IEIANKSGGRKKL"
     atgagtaatc gtaaaaacaa aaccacgaaa agcattgaaa tggacccgtc aaggggtgaa        60
     ctgctggttt atcagggcaa ggatggcgac atgaagctgg aggtgcggct ttacgatgac       120
     accatctggc tgacacaggc acagatgtcg gaactgtttg ccacggaccg tagcgttatc       180
     accaaacatc ttcgtaacat ctttaattcc ggagagttag aaaaagatgc agtatgtgca       240
     aaatttgcac atactgccga agacggcaag caatatcagg cccagtttta taatctggac       300
     gccatcattt ccgtgggata tcgggtcaac agtatccggg gaacgcaatt tcgcatctgg       360
     gccacccagc gcctgcgcga atatatcgtc aagggttttg ccttaaatga tgaacggctg       420
     aaagagccgg aaggcgggcg ctactttgaa gagttgctgg cccgtatccg tgatatccgg       480
     tcttcggaaa aggttttctg gcgcaaggta ctggatattt atgccaccag cattgactat       540
     gatcccacgg ttgagacctc tcagtcgttt ttcaagcagg tgcaaaacat gatgcactgg       600
     gccgcccatg gccacacggc ggctgaactg atttatgaac gcgccgatgc cgcgagaacc       660
     aatatgggag tgaccaatta tccgggcaat aaactgatca agcgcgatgt ggaagtggcc       720
     aagaattatt taaacgaaga agagctggat ctgctcaacc gcatcgtgac cgcatatctt       780
     gaggtcgctg aaattcaggc attgaaccgc aaccccatga ccatggccga ttggatagag       840
     cgcctgcacc agtttttaac catgaccggt cgtgatctgc tttcccacgc cggaaaaatc       900
     agccatgaag aggcgttgcg caaagcccac gaggaatacg aaaagttcag ggtcagacag       960
     ttagcggaac cgaccgaggc ggaaaaacac ttcgttgagg cggaaaaaaa actaaaccag      1020
     attgaaattg ccaataagag cggcggcaga aaaaaattat aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page