(data stored in ACNUC7421 zone)

EMBL: CP000859.PE246

CP000859.PE246       Location/Qualifiers
FT   CDS_pept        complement(277119..279092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0246"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   tfu:Tfu_0065 similar to uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66056"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS38"
FT                   /protein_id="ABW66056.1"
FT                   /translation="MKISTILDHIDSGHMALPEFQRGYVWNRDQVRALFDSLYRRHPVG
FT                   GLLVWATESRSATHRGDGPLAAGVVKLLLDGQQRMTTLYGVARGKPPKFFDGNLQVFTG
FT                   LRFHLESEIFEFYQPVKMKDDSLWIDVTGLMKNGSAGLGKFIATLSTNPELAPKIGDFA
FT                   GRLSQLLGILEIELHAEEVTGADKPLDVVVDIFNRVNSGGTKLSKGDLALAKICAEWPA
FT                   GRDVMRATLKKWADADYNFNLDWLLRSVNTVLTGEAKFLYLHEKSADEIKDALSRATRH
FT                   IDTCLNLISGRLGLDHDQVFFGRFGVPVMARYLDQRECNKLGSMNEKERDKLLFWFAQA
FT                   AMWGRFSGSTESFIDKDLEAIADGDGNLDPLLEQLRLWNGGLRVEAGHFTGWSLGARFY
FT                   PVLYLLTRMGGSRDWGTGLPLKANLLGKMNRLEVHHIFPKARLYKAKALDFRKPEVNAL
FT                   ANFCFLTKDSNLKISDRLPEEYFPEIEAAHPGALASQWIPDDPVLWTLDRYRDFLVARQ
FT                   KLLAAELNHQMETLLHGDTQWLSSGVSPKLEPAIVVGGISSENEEAELDKLNAWIESLG
FT                   LPSGVMSYDYADAQSGRQIAVFDLAWPLGLQEELSQPVAVLLNEEPATIALASQAGFRC
FT                   FTDGQAFRKYVEREMMAGDAHA"
     atgaaaatct ccacaattct cgaccacatc gacagcggcc acatggcact gccggagttc        60
     cagcgtgggt atgtctggaa tcgcgaccag gtgcgtgcct tgttcgattc tctttaccgt       120
     cgtcatccgg tgggtggctt gctggtttgg gccaccgaat ccaggtccgc gacccatcgt       180
     ggcgacgggc cactggcggc tggtgttgtc aagctgctgc tggacggcca gcaacggatg       240
     accaccctgt acggcgtggc gagaggtaag ccaccgaagt tttttgacgg caatttgcaa       300
     gttttcaccg gcctgcggtt tcatctggaa tcagaaatct ttgaattcta tcagccggtt       360
     aagatgaagg atgattcgct ttggatcgat gtgaccgggt tgatgaaaaa cggctccgcc       420
     ggattgggta aattcattgc cacgctcagc accaatcctg agctggctcc caaaatcggt       480
     gactttgccg gccggctaag tcaactgctg gggattctgg aaatcgaatt gcatgccgag       540
     gaggtgaccg gtgcggacaa gccgctggat gtggtggtgg atattttcaa ccgcgtcaac       600
     agcggtggca ccaagctttc caaaggggac ctggccctgg ccaaaatctg cgccgagtgg       660
     cctgcgggcc gcgatgtgat gcgggctacg ctcaaaaaat gggctgacgc ggattataac       720
     ttcaacctcg actggttgct gcgttcggtt aacaccgtgc tgaccggcga ggcgaagttc       780
     ctttatctgc atgagaagag cgcggatgag atcaaggatg cgctgagccg ggccaccagg       840
     catattgata cctgcctcaa cttaatcagt ggccggctcg ggctggatca tgaccaggtg       900
     ttcttcggcc ggttcggcgt gccggtgatg gcccgttatc ttgaccagcg cgagtgcaac       960
     aagctcggct caatgaatga gaaggaacgc gacaagctcc tcttttggtt tgcccaggcc      1020
     gcaatgtggg ggcgtttttc cggttcaaca gagtctttca tcgacaagga tcttgaggcg      1080
     attgccgacg gtgacggcaa tctcgatccg cttcttgaac aattgcgcct ctggaacggg      1140
     gggctgcggg tcgaggccgg gcatttcacc ggctggagcc tgggcgcacg tttttacccg      1200
     gtgctttacc tgttgacccg tatgggggga tcccgggact ggggcaccgg cctgccgctc      1260
     aaagcaaatt tgcttggaaa aatgaaccgg ctggaagtgc atcacatctt cccaaaggcc      1320
     agactttaca aagccaaagc cctcgacttc cgaaagccgg aggtgaacgc actggccaac      1380
     ttctgttttt taaccaaaga cagcaacctg aaaataagcg accggctgcc ggaggagtat      1440
     ttccccgaga tagaagcggc tcaccccggt gcgctggcct cgcaatggat tcccgatgac      1500
     cctgtactgt ggacgctgga tcggtaccgg gactttctgg tggctcgtca aaaactgtta      1560
     gccgctgaac tgaatcacca gatggagacg ttgcttcacg gagatacaca atggctttcc      1620
     agtggcgtct ctccgaagct ggaacctgcc atagtagtgg ggggaatcag cagcgaaaat      1680
     gaagaggccg aactggacaa acttaatgcc tggatagaat cacttgggct gccttccggc      1740
     gtgatgtcat acgactatgc cgatgcccag tccggccggc agatcgcggt gtttgatctg      1800
     gcctggcccc tgggactgca agaggaattg agtcagccgg tggctgtctt acttaatgag      1860
     gagcccgcca ccatcgccct ggccagtcag gccggttttc gttgttttac cgatggtcag      1920
     gcattccgca aatatgttga acgtgaaatg atggcgggag atgcccatgc ctga            1974
//

If you have problems or comments...

PBIL Back to PBIL home page