(data stored in ACNUC7421 zone)

EMBL: CP000859.PE247

CP000859.PE247       Location/Qualifiers
FT   CDS_pept        complement(279465..281609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0247"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   fjo:Fjoh_2693 protein of unknown function DUF262"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66057"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS39"
FT                   /protein_id="ABW66057.1"
FT                   /translation="MRTGRYSIAELFGNRHIEQLVIPEIQRDYVWKAEQVQGLLDSILK
FT                   NFNDWKQAKGTPRFKVVPEEPQDIEKHPSLENDFTAFYAQRYHGTNIGFVYAYSDGDLP
FT                   GQYYLIDGQQRLTTLYLVLLAVASRNDDLKERFRARYCLQSTDANPGAKAIPTKLDYRL
FT                   REHITDFFHHCVPYLLENPEHAETLQQQSWYRKRLDEDKTVKNLINNFTKIYSHLENEL
FT                   DSDCSDDAFKYLDDLVDCWYFDTNESVQGEELYIYLNARGESTATNENKKAELLKSLSD
FT                   EKKEDWGKKWEEWQDFFWQKRRKGLEDKHNNPNADRGFNSFLACIKNLEKLKNKGGNEC
FT                   EETSLEVIEKYLSALKWLGDNKGSFKKLYSYSGWVDSWFNEIWSVFNNPAMTDWDANFK
FT                   DDKKPTERNKMVLIWGSLLSIFSYFERNDWEPVRINIDDIERIFRTIRIFWLRYKNYNR
FT                   SVASLPAAVKDILFNDSPEFIGSESKEEALKWNLLKNTGDEERRHFEAVIWEIEDHPFN
FT                   IDGRDLDNQNISHLVDLNEQLTLETLNNVKETFYRLFPKDNKKQEERTIAQILLYYGEF
FT                   WHHISPWYHKNYDFSDWRRTIRGKGNVEQNVAASTTVFRLFFQDFMKKNKSPNEFLKMK
FT                   QDEWPESIDPVSETSLRKALIWYSQKLQDNFLKEGMYVVIDRPQYEESDANFPKLSPIW
FT                   NTSGSFKGRNKKMSEQKENG"
     atgaggacag gacgctacag catagctgaa ctgtttggca atcgccacat agagcaactg        60
     gtgattccag agatacaacg cgactatgta tggaaagctg agcaggttca gggcttgctg       120
     gactcgatcc taaaaaattt caatgattgg aaacaagcaa aggggactcc tcgttttaaa       180
     gttgttccag aagaacctca ggatattgaa aaacatcctt ccctggaaaa cgacttcacg       240
     gcgttctatg cacagcggta ccatggcact aatatcggat ttgtctacgc atacagcgat       300
     ggcgatcttc ctggacaata ttatctgatt gatgggcagc aacgtctaac cacattatac       360
     cttgttcttt tagcagtagc ctctcgcaac gatgatctta aagagcgatt tcgagcacgt       420
     tattgcctcc agtcgactga tgccaatcct ggtgcaaagg caattccaac caaacttgat       480
     tatcggttgc gggaacatat taccgatttt ttccaccatt gcgtacctta tcttttggaa       540
     aatccggagc atgccgaaac actccaacaa caaagctggt accggaagag actggacgag       600
     gataaaaccg tcaaaaacct gatcaataat tttactaaaa tctattcgca tttagagaac       660
     gaactggata gtgattgttc agatgacgct ttcaaatacc tggatgatct tgtggattgt       720
     tggtatttcg ataccaatga aagcgttcag ggtgaggaac tttatatcta tctcaacgcc       780
     cgcggcgaaa gtaccgcaac gaatgagaac aaaaaagcgg agttgcttaa gtccctatct       840
     gatgagaaaa aggaagattg ggggaaaaaa tgggaagaat ggcaggattt cttctggcag       900
     aaacgtcgaa agggacttga ggataagcat aataacccca atgccgaccg gggattcaac       960
     agctttctgg catgcatcaa aaatcttgag aagctgaaga acaagggagg caacgagtgc      1020
     gaagaaacat ctctcgaagt catagaaaaa tatttatccg cacttaaatg gttgggagac      1080
     aataaaggca gtttcaagaa attatactct tactcggggt gggtcgattc atggtttaat      1140
     gaaatatgga gcgtttttaa caatccggcg atgacggatt gggacgctaa ttttaaagac      1200
     gataaaaaac ccacagaacg caacaagatg gttttgatat ggggcagtct tctttcaatc      1260
     ttcagctatt ttgaaagaaa tgactgggaa cccgtgagaa ttaatattga tgatattgaa      1320
     cgtatatttc gaacgattag aattttttgg cttcgataca aaaactataa ccgctccgtt      1380
     gcttccctac cggcggctgt aaaagacatc ctgtttaatg actctccgga gtttataggt      1440
     tccgaatcca aggaggaagc attaaagtgg aaccttctta aaaatacggg agacgaagaa      1500
     cgccgtcatt ttgaagcggt catatgggaa atcgaagacc atccttttaa catagacggc      1560
     cgcgatcttg acaaccagaa tatcagccat ctcgtcgatt tgaacgaaca gttgacatta      1620
     gaaacactta ataatgtcaa agaaacattc tacaggcttt tcccaaaaga taacaagaaa      1680
     caagaagagc gcaccattgc ccaaatattg ctttattacg gtgaattctg gcatcacatc      1740
     agcccatggt atcataaaaa ctacgatttc agtgattgga gacgaaccat tcggggtaaa      1800
     ggtaatgttg agcaaaatgt cgcggccagc acgacggtat tccgactatt tttccaagac      1860
     tttatgaaga agaataagag cccaaacgag ttcttgaaga tgaaacagga cgaatggcca      1920
     gagagtattg atcctgtttc tgagacatcc ttgagaaaag ccctgatatg gtatagccaa      1980
     aaattgcagg ataacttcct taaggaaggg atgtatgtgg tgatagaccg gcctcaatac      2040
     gaagagagcg atgccaattt cccaaaactt agtccgatct ggaatacatc aggttccttt      2100
     aaaggtagga acaaaaaaat gtcggagcag aaggaaaatg gctaa                      2145
//

If you have problems or comments...

PBIL Back to PBIL home page