(data stored in ACNUC7421 zone)

EMBL: CP000859.PE249

CP000859.PE249       Location/Qualifiers
FT   CDS_pept        complement(283450..284631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0249"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: sbm:Shew185_2194 restriction
FT                   modification system DNA specificity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66059"
FT                   /db_xref="GOA:A8ZS41"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS41"
FT                   /protein_id="ABW66059.1"
FT                   /translation="MKSKENSQFSTRHSPSVPPGYKQTEVGVIPEDWEVKPLAFVVKYT
FT                   NGKAHEQSITDSGNFVVVNSKFISTEGIIRKFAQMRFCPAEKGDVLMVMSDVPNGRAIA
FT                   KCFWVDCEDTYTVNQRICVLNPCGIDGKLLYYKLDRNPFYLTFDDGAKQTNLRKEDVLS
FT                   CPLSIPNTEAEQRAIAAALSDVDALLDGLDRLIAKKRDLKQAAMQQLLTGQTRLPGFKG
FT                   EWEIKRLGDVLMVRHGKSQRGISVSDGKYPILASGGEIGRTNTCIYDKPSVLIGRKGTI
FT                   DSPQYVDSPFWTVDTLFFTEISTEANAKFIFSKFSIIPWRTYNEASGVPSLNAKTIENI
FT                   EIFLPSPTEQTAIAQVLSDMDAEIAALEQRRNKTRDIKQAMMQELLTGKTRLV"
     atgaaaagca aagaaaattc tcaattctca actcgccatt ctccatcggt tccgccggga        60
     tacaaacaga ccgaggtggg ggtgattccg gaggattggg aagttaagcc tctcgctttt       120
     gttgtgaaat acacaaacgg aaaggcgcac gagcaaagca tcacggattc gggcaatttt       180
     gtggttgtaa attccaagtt catttcaact gaaggtatca ttcgtaaatt tgctcaaatg       240
     cgtttctgcc cagcggagaa aggggatgtg ctcatggtga tgagcgatgt cccaaacgga       300
     agagccattg caaaatgttt ttgggtagat tgcgaagata cttacactgt caatcagcgt       360
     atttgtgtcc tgaatccttg tgggatagat ggcaaacttc tgtattacaa actcgaccgg       420
     aatccgttct atttgacatt tgatgatggt gctaaacaga cgaacctccg aaaggaagac       480
     gtcctttctt gccctctgtc aattccaaat accgaagccg aacaacgcgc catcgctgcc       540
     gccttgagcg acgtggatgc cctgctggat ggcctcgacc ggctgatcgc caaaaagcgc       600
     gacctcaaac aggccgccat gcagcaactc ctcaccggcc aaacccgcct gccggggttt       660
     aagggggagt gggagattaa acggttgggg gatgtactta tggtccgtca cggcaagagt       720
     cagcgcggca tctctgtgtc tgacgggaag tacccgattc ttgcatccgg tggagaaatt       780
     ggacgaacca atacctgcat ttacgacaag ccctctgttt tgattgggcg aaaaggaacg       840
     attgattcac cacagtatgt ggactctccc ttttggacgg tggacacgtt gttttttacg       900
     gaaatttcta ccgaagcgaa cgccaagttc attttttcca agttctctat aatcccttgg       960
     agaacttaca acgaggcttc gggtgtgccc agcttaaacg caaaaactat cgaaaatatc      1020
     gagatttttt taccctcccc caccgaacaa accgccatcg cccaagtcct ctccgacatg      1080
     gacgccgaaa tcgccgccct ggaacagcgc cgcaacaaaa ccagagacat caaacaggcc      1140
     atgatgcagg aacttttaac tggaaagacg aggctggtat ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page