(data stored in ACNUC7421 zone)

EMBL: CP000859.PE25

CP000859.PE25        Location/Qualifiers
FT   CDS_pept        complement(25106..27145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0025"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: pth:PTH_1792 primosomal protein N'
FT                   (replication factor Y) - superfamily II helicase; TIGRFAM:
FT                   primosomal protein N'; PFAM: helicase domain protein; type
FT                   III restriction protein res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65835"
FT                   /db_xref="GOA:A8ZRR8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR8"
FT                   /protein_id="ABW65835.1"
FT                   /translation="MSDSRYIEVAIHLPVFQTYTYSVPEPLLLQAVCGRRVQVPFGRQM
FT                   VAGTVLGEATACDNAEIKPVAAVLDDGPLFPATMIPFFRWVADYYLYPLGETIANALPA
FT                   GDLPKKSAPPVGKIPKDAVGDPILPDTPPDLTTDQEAVVADLVSRLDAGFCSCLLAGIT
FT                   GSGKTEVYMRVVAAALAMGKTALVLVPEIALIAQAEHRFCARFGHTVAVLHSGLSRTER
FT                   WHQWSKIARGEAAIAIGTRSAVFAPLDRPGIIIVDEEHDTSYKQESGLRYNACDLAVVR
FT                   AKLSDAVVVLGSATPSVQSLHNATTGKFSKTYRMDRRINRQPLPAITVVDLREQQARRG
FT                   PRAYISDELHRAMAETLAQGNQVLLFLNRRGFASLPVCAACGNTIKCKHCDISLTLHKG
FT                   ANAFRCHFCGYSRAAARGCDICGSSSIKLLGLGTEKVEEAVKQLFPEASVARLDRDTTT
FT                   RKGAMLRILKDLKNRKIDILVGTQMIAKGHDFPGITLIGVICADLSLNFPDFRAGERTF
FT                   QLLAQVAGRAGRGVDPGRVILQTYNPDHLCIAAATRQDGSAFYDQEIAFRRQLGYPPFS
FT                   RMVHLHISATDPAKAKARAREAGDCCTALKNSAPAVFGAVEVLGPVEAPIHKLASRYRW
FT                   QILLKSRSAAAVKSFAARLLAQDGQRLRKGGVRLVVDVDPFFMM"
     atgtccgaca gtcgatacat agaggtggca atccacctgc cggtttttca gacctacacc        60
     tacagcgttc ccgaaccgct tcttctgcag gcggtttgcg gccggcgggt gcaagtgccc       120
     tttggccggc agatggttgc cggcacggtg cttggcgagg cgaccgcctg tgacaatgct       180
     gaaataaaac ccgtggcggc cgtgctggac gacgggcccc tgtttcccgc caccatgatt       240
     ccctttttcc ggtgggtcgc cgactactac ctgtatcccc tgggtgaaac cattgccaac       300
     gccctgccgg caggagacct gccgaaaaaa agcgcgccgc cggtcggaaa aattccgaaa       360
     gacgccgtgg gagaccccat tctgccggac acgccgccgg acctgaccac cgatcaggag       420
     gccgtggtgg cggacctggt ttcccgtctg gatgcggggt tctgctcctg cctgctggcc       480
     ggcatcaccg gcagcggcaa aaccgaagta tacatgcggg tggtggccgc agccctggcc       540
     atgggcaaaa ccgccctggt gctggtgccg gagatcgccc tgatcgccca ggccgagcac       600
     cggttctgcg cccggttcgg ccataccgtg gccgtgctgc acagcggcct ctcccggacc       660
     gagcgctggc accagtggtc aaagattgcc cggggtgaag cggccattgc catcggcacc       720
     cggtcggcgg tgtttgcgcc cctggaccgg ccggggatca tcatcgtgga tgaggagcac       780
     gacacctcct acaagcagga gagcggcctg cgctacaatg cctgcgacct ggccgtggtc       840
     cgggccaagc tttcggacgc cgtggtggtg ctggggtcgg ccacaccctc ggtccagtcg       900
     cttcacaacg cgacaaccgg caagttttcc aaaacctacc ggatggatcg gcgcatcaac       960
     cgccagcccc tgccggccat caccgtggtg gaccttcggg aacagcaggc ccgccggggc      1020
     ccccgggcct atatcagcga cgagctgcac cgtgccatgg cggaaaccct ggcgcagggc      1080
     aaccaggtgc tgctgttttt aaaccgccgg gggtttgcca gcctgccggt gtgcgcggcc      1140
     tgcggcaaca ccattaaatg caaacactgt gacatctccc tcaccctgca caagggggcc      1200
     aatgccttcc ggtgccattt ctgcggctat tcccgggccg cggccagggg ctgcgacatc      1260
     tgcggatctt cctccatcaa gctgctgggc ttgggcacgg aaaaggtgga agaagcggta      1320
     aaacagcttt ttcccgaggc atcggtggcc cggctggacc gggacaccac cacccggaaa      1380
     ggggccatgc tccgtattct caaagacctg aaaaatcgga agatcgacat tctggtgggc      1440
     acccagatga tcgccaaggg ccacgacttt cccggcatca ccctgatcgg ggtcatctgt      1500
     gccgacctct ccctgaattt tcccgatttc cgggccggcg agcggacctt tcagcttctg      1560
     gcccaggttg cgggccgggc cggccggggc gtggatcccg gccgggtgat tctgcagacc      1620
     tacaacccgg atcacttgtg tatcgccgcc gccacgcgcc aggacgggtc ggccttttac      1680
     gaccaggaga tcgcctttcg ccggcagctg ggctacccgc ccttttcccg gatggttcac      1740
     cttcacatct cagccacgga cccggcaaag gcaaaggcac gggcacggga ggccggggat      1800
     tgctgcacgg ccctgaaaaa cagcgccccc gcggtctttg gcgctgtgga ggtgctgggc      1860
     ccggtggagg cccccattca caagctggcc agccgctacc ggtggcagat ccttttaaaa      1920
     agccggtccg cggcagcggt caagtccttt gccgcccggc ttctggccca agacggccaa      1980
     cggctcagaa agggaggcgt ccggctggtg gtggatgtgg atcccttttt catgatgtaa      2040
//

If you have problems or comments...

PBIL Back to PBIL home page