(data stored in ACNUC7421 zone)

EMBL: CP000859.PE253

CP000859.PE253       Location/Qualifiers
FT   CDS_pept        289727..290275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0253"
FT                   /product="Cell division GTPase-like protein"
FT                   /note="KEGG: jan:Jann_2750 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66063"
FT                   /db_xref="GOA:A8ZS45"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS45"
FT                   /protein_id="ABW66063.1"
FT                   /translation="MSTGIGETDFMIAVAGGAGINCANRLMERKLNRSWFMAVDTDVSA
FT                   LARCAAFRKITVNSRETGADFEQRVSPLLGHRRRLFVIAGLGGEAGSSFALWLAEYGSR
FT                   RQMSVECFVFLPFLFEGARNQRADETLEKLEPIVYRLHVFKNDDLRNRNLNAMTMTQVF
FT                   DVLHDAVFCRLAPCLEQGG"
     atgagcaccg gaatcgggga aacagatttt atgattgccg ttgccggggg cgcggggatc        60
     aactgcgcaa accgcctgat ggaaagaaag ctgaaccggt cctggtttat ggcggtggac       120
     accgacgtgt cggctcttgc ccggtgcgcg gcctttcgaa agatcacggt aaacagccgg       180
     gagaccgggg ccgattttga gcagcgggtg tcgcccctgc ttggtcaccg gcggcggctg       240
     tttgtgattg cgggccttgg gggcgaggcc ggttccagtt ttgccctgtg gcttgccgaa       300
     tatggcagca ggcggcagat gagtgtggag tgctttgtgt ttctgccgtt tctgtttgag       360
     ggcgcaagaa atcaaagggc tgatgaaaca ttagaaaagc tggagccgat tgtttaccgg       420
     cttcatgtgt ttaaaaacga tgacttgaga aaccgcaact taaacgccat gacaatgacg       480
     caggtctttg acgtgttgca cgatgcggtg ttttgcaggc ttgccccctg tcttgaacaa       540
     gggggctga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page