(data stored in ACNUC7421 zone)

EMBL: CP000859.PE256

CP000859.PE256       Location/Qualifiers
FT   CDS_pept        291527..292033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66066"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS48"
FT                   /protein_id="ABW66066.1"
FT                   /translation="MEQTKVLVYFNQKKGVFSVETLEGENKGRVIAHVQKITLTECRFS
FT                   KNKDKTAGIIGMWQERFRDMDPSRAVGHYFEAEEDADGFSPVYYGELFKYDSRSERYIV
FT                   DDDGDFMAFSHETSQELQNDPNFEQATLDKPALVCMDLWEDEDPKAEDVRGIAYYWRKK
FT                   SKKLS"
     atggaacaaa caaaagtact ggtgtatttt aaccagaaaa aaggggtatt cagtgttgaa        60
     acccttgaag gcgaaaataa agggagggtt attgcccacg ttcaaaaaat aacgctcacg       120
     gagtgcaggt tcagcaaaaa taaagacaaa acagccggta taatcggcat gtggcaggaa       180
     cggttcaggg atatggatcc gtcaagggct gtgggccact attttgaggc cgaagaagac       240
     gcagacgggt tttcacctgt ttattatggt gaactattta agtatgattc caggtctgaa       300
     cggtatattg tagatgatga tggcgatttc atggccttct ctcacgagac gagccaggaa       360
     ctccagaacg acccgaattt tgaacaggca acccttgaca aaccggccct ggtctgtatg       420
     gatctatggg aggacgaaga cccgaaggca gaggatgtaa gggggatcgc ctattattgg       480
     cgaaaaaaaa gcaaaaaact ttcatga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page