(data stored in ACNUC7421 zone)

EMBL: CP000859.PE258

CP000859.PE258       Location/Qualifiers
FT   CDS_pept        292508..293143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS50"
FT                   /protein_id="ABW66068.1"
FT                   /translation="MTDTIMEYKIQADPEQLQPWPALKKKLSTSAPEIPGGGFRQSRRV
FT                   QGMIDCHSLARGYSQLFIYIQKGLGAYAVEISKMIKTIYSIKDSDIRLRLYLAAFGDPE
FT                   LTVHPRPYTTYGYKTATRTIVENLAGEGIKTPCLLDTLDMNPYLKAGQYRRADRGLIII
FT                   FASALEDVRFSETAMEKLSRQKNSYIVAVSGEEVKGALLRQPNFEQEG"
     gtgactgaca ccattatgga atataaaatt caagcagatc ccgaacaact gcaaccctgg        60
     ccggctttaa agaaaaaact cagcaccagc gccccggaaa tacctggggg tggattcagg       120
     caatcccgac gggtccaggg gatgatagat tgccacagcc tggcaagggg ctacagccag       180
     ctctttattt atatacaaaa ggggttgggt gcgtatgcgg tagaaatatc gaaaatgatc       240
     aaaacaattt attccattaa agacagtgat ataaggctcc ggctttacct ggccgcattt       300
     ggcgacccgg agttgaccgt ccacccccgg ccatacacga cctacgggta caaaacagca       360
     acaaggacaa tagtggaaaa cttggccggt gagggcataa aaacgccttg cctcctggat       420
     accctggata tgaatcctta tttaaaagcc gggcaataca gaagggctga caggggcttg       480
     atcatcattt ttgcaagtgc gttggaagat gtgcggtttt cagaaacagc catggaaaaa       540
     ctgtcgaggc agaaaaacag ctatatagtg gcggtaagcg gagaagaggt taagggtgca       600
     ttgttgcggc aaccaaattt tgaacaggag ggttaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page