(data stored in ACNUC7421 zone)

EMBL: CP000859.PE262

CP000859.PE262       Location/Qualifiers
FT   CDS_pept        299412..300380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66072"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS54"
FT                   /protein_id="ABW66072.1"
FT                   /translation="MTTTRTISRCDFLLNALAACAGTVLPLSLSAPSPTDSLAPSPRPI
FT                   EIKRLAPMTHPDDSFKTTVFCMGRPGLYAVSRMVHRFGHIDRNVDYLFVDTHDTEDTNL
FT                   YLPEATRTLLTDLLAESHLALIVADTERGIPEALRTQFAEWRRQSSNMTVTFCLAPAAP
FT                   ANARQPVWTRQPNDVIVNVPATPADTTALMPYAIFGLCHPVYYPGLVGLDLDDIKTVLS
FT                   RTGGIRFGMATAVGENRPATAMRKALKQVYAGIPPSAVQTGLLAFITTNDEDDLSFEDL
FT                   TEAADLLHEALRPFDNAEYTWAHRVTPSVKKGEVLVTVYAG"
     atgaccacaa cccgaactat aagtcgctgc gactttcttc tgaacgctct ggccgcatgc        60
     gccggaaccg ttctcccatt gtcgttatct gcaccctcgc cgaccgactc gctggcgcca       120
     tcgccccggc ccatagaaat aaaaaggctt gctcctatga ctcatcctga tgattctttc       180
     aaaacaacag tcttctgcat gggcagaccc ggcctgtatg ctgtttcacg gatggtccac       240
     cggttcggcc acatcgaccg caacgtggac tacctctttg tggacacgca cgacacagaa       300
     gacaccaacc tgtatctgcc ggaagcaacc cgcacccttc tcacagattt gttggccgaa       360
     agccacctgg cactcattgt cgccgacacg gaaaggggta tacccgaagc actgcgcact       420
     caatttgccg aatggcgcag acaatcttcc aacatgaccg taaccttttg cctggccccg       480
     gccgcgccgg caaatgcccg gcaacctgta tggacccggc agccaaacga cgtcattgtg       540
     aacgtccccg caacaccagc cgacacaacc gcattaatgc cgtacgcgat ttttggcctc       600
     tgtcacccgg tctattatcc ggggcttgtg ggccttgatc ttgacgacat caaaaccgtt       660
     ttaagccgta cagggggcat acgatttggc atggctaccg cggtcggcga aaatcgcccg       720
     gcaacagcca tgcggaaggc gctgaagcaa gtctatgccg gcattccccc gtccgccgtg       780
     caaacagggc tcctcgcctt catcacaacc aacgacgaag atgatctctc cttcgaagat       840
     ctgacagagg ccgcggacct gctgcacgaa gcccttcgcc cttttgataa tgcggagtat       900
     acctgggcgc accgcgtgac gcccagcgtg aaaaaaggcg aggtgctggt cacggtttat       960
     gccggataa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page