(data stored in ACNUC7421 zone)

EMBL: CP000859.PE265

CP000859.PE265       Location/Qualifiers
FT   CDS_pept        302163..303782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0265"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   esa:ESA_00407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66075"
FT                   /db_xref="GOA:A8ZS57"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS57"
FT                   /protein_id="ABW66075.1"
FT                   /translation="MENRHKIEHYEGCLLGGAVGDALGAPVEFMSLDDILRRFGPSGIV
FT                   DYAPVSGKTGAITDDTQMTLFTAEGMLRSVTRWRHKGVCYPPAVVYYSYQRWLMTQDSS
FT                   VDKDGDVSWLMDIPELHSERAPGSSCLSALRSSRQGSMKEPINDSKGCGGVMRIAPVGL
FT                   TQALEIVFETGCEVAALTHGHPTGYLAAGCLAQIIRHIIDGYSLIQAIEATQAILAEQR
FT                   DCEECRDAIGAALLAWRRKQPSFETVETLGEGWIAEEALAIGIYCALVGGDDFERGVTL
FT                   AVNHSGDSDSTGAITGNIMGALLGVSAIPQRYLDQLELKDVITELADDLYTGFKEGDGW
FT                   WNKYPGSGLYFRSKEEDVEHYTVPFDRCYWVVPGKLMAGCYPGGLNKEEARKTLQGLLD
FT                   HGIRHVVSLMEPDEKDHAGKPFISYEPLMQSLAIAAGKAVTFARFPIKDQNIPTEDEMV
FT                   GILDHIGREIDASIPVYVHCWGGKGRTGTVVGCYLARHGLASGKSALRGIQELRRDVAD
FT                   AHHASPETDPQKKMVISWARGQ"
     atggagaata gacataagat tgagcattat gagggctgcc tgttgggcgg cgcggtgggt        60
     gacgcccttg gtgcgcctgt ggagtttatg tcgcttgacg acatccttcg tcggttcggc       120
     ccgtccggga tagtagatta cgcccctgtc tccggtaaaa ccggtgctat cacggatgat       180
     acccagatga ccctgtttac ggccgaaggt atgctgcggt ctgttacccg gtggcggcat       240
     aaaggggttt gttatccacc cgccgttgtt tattattcat atcaacgctg gctgatgacc       300
     caagatagca gtgttgataa ggatggggat gtcagctggc tgatggatat cccggaacta       360
     cacagcgaac gagcgccggg cagttcctgt ctgtccgcat tacggtcttc tcgccagggc       420
     agcatgaaag aaccgattaa tgacagcaaa gggtgcggcg gtgttatgcg gatcgccccg       480
     gttggactga cccaggctct ggagatagtt tttgaaacgg gctgcgaggt ggcggccctt       540
     acccatggcc acccaacggg ctatcttgcg gccggatgcc tggcccagat catccggcac       600
     attatcgatg gatacagcct tatccaggca attgaagcca cccaggccat ccttgcggag       660
     cagagagact gtgaagaatg ccgggatgca atcggggccg ctcttcttgc ctggcggcgt       720
     aaacaacctt cctttgaaac cgtagagacc ctgggggaag ggtggattgc cgaagaggcc       780
     cttgccatag gaatttactg cgcgctggtg ggcggtgatg attttgaaag gggcgtcacc       840
     ctggcggtga accacagcgg cgattccgac agcaccggcg ctatcacggg aaacattatg       900
     ggcgccctgc taggggtatc cgccattccc cagcggtatc tggatcaact ggaactaaaa       960
     gacgtcatca cggagcttgc cgacgactta tatacgggtt ttaaagaggg tgacgggtgg      1020
     tggaataaat acccgggcag cgggctatac ttccggtcta aagaagagga tgttgaacac      1080
     tataccgttc cttttgaccg ttgttactgg gttgtccccg gtaaactgat ggccgggtgt      1140
     tatccgggtg gtctgaataa agaagaggcc cgaaaaacat tgcagggcct gctggaccac      1200
     ggtatccggc atgtggtcag cctgatggag cccgatgaaa aggaccacgc cggcaagccg      1260
     ttcatctcat acgaaccgct tatgcagtct ctggcgattg cagcgggtaa agccgtcacg      1320
     tttgcccggt ttccaataaa ggatcagaat atccccacag aagatgaaat ggtcggcatt      1380
     ctggatcata ttggccggga aattgatgcc tcaatacctg tgtatgtgca ttgctggggt      1440
     ggcaagggaa gaaccggcac ggtagttggg tgttatctgg ccaggcatgg ccttgcgtcc      1500
     ggtaaaagtg ctttgcgggg catacaggaa ctcaggcgag atgtggcaga cgcccatcat      1560
     gcctctcccg aaacagaccc acaaaagaag atggttattt cctgggcgcg gggccagtaa      1620
//

If you have problems or comments...

PBIL Back to PBIL home page