(data stored in ACNUC7421 zone)

EMBL: CP000859.PE269

CP000859.PE269       Location/Qualifiers
FT   CDS_pept        308652..308903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66079"
FT                   /db_xref="GOA:A8ZS61"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS61"
FT                   /protein_id="ABW66079.1"
FT                   /translation="MFGKRTSSGKGRGDEPVYRSYKQCPDCLARMPLNATRCPECNQRV
FT                   GEIQADGKALKPTDWKSYIVTAILFALFYFFVRWAFFT"
     atgtttggca aacgaacatc gtcaggcaag ggccggggcg acgagcccgt ctatcgttcc        60
     tataaacagt gcccggactg tcttgccagg atgccgctga acgcgaccag gtgtccggaa       120
     tgcaaccagc gtgtggggga gattcaggcc gacggcaagg cccttaaacc caccgactgg       180
     aagagctata tcgttaccgc cattctgttt gccctgttct atttttttgt gcgatgggcc       240
     ttttttacct ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page