(data stored in ACNUC7421 zone)

EMBL: CP000859.PE270

CP000859.PE270       Location/Qualifiers
FT   CDS_pept        308974..309252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66080"
FT                   /db_xref="GOA:A8ZS62"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS62"
FT                   /protein_id="ABW66080.1"
FT                   /translation="MLNSKNFWYANMAGAVAGWAFIIFGAAAPFSGLLYGLWVVVTLLW
FT                   VIGHPLELAMAIPVAMKAGYSPAAAVVYTLVFGITWWIPVKWGVFKP"
     atgctgaata gtaaaaattt ctggtatgcc aacatggccg gtgctgttgc gggatgggct        60
     tttatcattt tcggcgcggc cgcgcccttt tccggccttc tgtacggcct ctgggtcgtt       120
     gttaccctgc tgtgggtcat cggccacccc ctggaactgg ccatggccat tcccgtggcc       180
     atgaaagccg gctattcgcc cgctgccgcc gtggtctata cccttgtttt cggtatcacc       240
     tggtggatac cggtcaagtg gggcgtcttc aaaccctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page