(data stored in ACNUC7421 zone)

EMBL: CP000859.PE271

CP000859.PE271       Location/Qualifiers
FT   CDS_pept        309555..310406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0271"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   swo:Swol_1485 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66081"
FT                   /db_xref="GOA:A8ZS63"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS63"
FT                   /protein_id="ABW66081.1"
FT                   /translation="MEVKTIMVIGAGQMGNGIAQVAAQAGYTTFMNDISEDLVDRGMTA
FT                   IAGSLDRMVKKEKITADDKTAILGRITPAVTLDPASECDLVIEAVVEKMSIKADIFSAL
FT                   DRLAPGHAILASNTSSLPITGIAAHTGRPEKVIGMHFMNPVPVMKLVEVINGLATTPEV
FT                   TATVRAVAEAMGKIPVECRDVPGFVSNRVLMVMINEALWELYEGVATAEGIDQIMKLGM
FT                   NHPMGPLALADLIGLDTVLAILGVLQDGYGDPKYRPSPLLKSYVAAGWLGRKTGRGIYE
FT                   YK"
     atggaagtta aaaccataat ggttatcggc gccggccaga tgggcaacgg catcgcccag        60
     gtggcggccc aggccggtta taccaccttt atgaacgata tctccgaaga cctggtggac       120
     aggggcatga ccgccattgc cggcagcctg gaccggatgg ttaaaaaaga aaaaatcacg       180
     gctgacgaca agaccgccat cctgggccgg atcacaccgg cggtgaccct ggacccggcg       240
     tccgaatgcg acctggtaat agaggcggtg gtggaaaaaa tgtcgatcaa ggccgatatt       300
     ttcagcgccc tggaccggct ggcccctggc cacgccattc tggccagcaa cacatcctcg       360
     cttcccatca ccggcattgc cgcccatacc ggacggccgg aaaaggtgat cggcatgcat       420
     tttatgaacc ctgtgccggt gatgaagctg gtggaggtca tcaacggcct ggccacgacc       480
     ccggaggtga cggccacggt gcgcgcggtg gccgaagcca tgggcaaaat accggtggag       540
     tgccgggacg tgcccggatt tgtctccaac cgggtgctca tggtcatgat caacgaggcc       600
     ctgtgggaac tttacgaagg cgtggccacg gccgaaggca tcgaccagat tatgaagctg       660
     ggcatgaacc atcccatggg tcccctggcc ctggccgacc tgatcggcct ggacacggtg       720
     ctggccattc tgggcgtgct tcaggacggg tacggcgacc ccaagtaccg gccctctccg       780
     ctgctcaagt cctacgtggc cgccggctgg ctgggccgca aaaccggcag gggtatctac       840
     gaatataagt aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page