(data stored in ACNUC7421 zone)

EMBL: CP000859.PE273

CP000859.PE273       Location/Qualifiers
FT   CDS_pept        complement(310875..311600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0273"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   gur:Gura_0899 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66083"
FT                   /db_xref="GOA:A8ZS65"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS65"
FT                   /protein_id="ABW66083.1"
FT                   /translation="MEHLADPNIWLALTALTALEIVLGIDNIVFIAILAGRLPEDQQAA
FT                   GRRVGLALALITRILLLFSLTWIMRLTAPLFSVLDNPVSGRDIILIAGGLFLLAKSTVE
FT                   IHAAIEGEADRHAERKGGIAPSFFSVVTQIMVLDIVFSLDSVITAIGLAQQIWVMVTAI
FT                   VIAVGVMIVMADMVSAFIEKHPTVKMLALSFLLLVGLALIGDGVDLHIPRGYIYFAMGF
FT                   SVFVEVLNLRIRGRKKSAA"
     atggaacacc tggcagaccc caatatctgg ctggccctga cggcgctgac ggccttagag        60
     attgttctgg gcattgacaa catcgtgttt atcgccattc tggcgggccg gctgccggaa       120
     gatcagcagg ccgcgggaag gcgcgtgggc ctggccctgg ccctgattac ccgaatcctt       180
     ttgctttttt ccctgacctg gatcatgcgg ctgaccgcgc ccctgttttc ggtgctggac       240
     aacccggtgt cgggccggga catcatttta atcgccgggg gtttgtttct gctggccaag       300
     agcacggtgg agattcacgc ggccatcgag ggagaagcgg acaggcacgc ggaacgaaag       360
     ggcggcatcg cgccctcctt tttttccgtg gtaacccaga tcatggtgct ggatatcgtg       420
     ttttccctgg attcggtgat cacggccatc ggcctggccc agcagatatg ggtgatggtc       480
     acggccatcg tgattgccgt gggggtgatg atcgtgatgg ccgacatggt gagcgccttt       540
     atcgaaaagc accccacggt caagatgctg gccctctcct ttctgctgct ggtgggcctg       600
     gccctgatcg gcgacggggt ggacctgcac attccgcgcg gctacatcta ttttgccatg       660
     gggttttccg tgttcgtgga ggtcttgaac ctgcggattc gcggccggaa gaaaagtgcg       720
     gcatga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page