(data stored in ACNUC7421 zone)

EMBL: CP000859.PE275

CP000859.PE275       Location/Qualifiers
FT   CDS_pept        314319..316082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0275"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: fnu:FN1787
FT                   tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66085"
FT                   /db_xref="GOA:A8ZS67"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS67"
FT                   /protein_id="ABW66085.1"
FT                   /translation="MDMNRMTISILLVVSILTFNSAFLCADSKFLDSSKTPEKEMDYKF
FT                   IAPKTTIETGVIMTKDGQNIVARKISEDNNVIVYYLGHIAHGITVDKVLSIANTSGSGL
FT                   IGFSEGDRRDSLNGSGFQAEPKTSITKVENLDDVNFIDGGKFFEKGNYTEAIQAYSLYL
FT                   RYYPKSPTGYSNLGLCYLQKGNFKEALKYHTKAIELDDNRANLYIARSVSYWKMGLNDL
FT                   AFADIEKAIELNPNNKDAYLKKGKFLFNKEEYKNAIKPFLKYLELGGNNWEALSALGWA
FT                   YHKTDNDRDALKYLMIAHQSNEGSYDNNIRMADVYRGLKEYENAIKYYTLALNTDKKDI
FT                   FLYLYRGISYMEKGDYSLAELDFKKALELKENDPVVLCNYAQLYIYQDKDRKAIPLLKK
FT                   VLEVSKDEECNIWSKFTLEEISKSRKKTRNVIALFLIFIALIFLILLGVLKLKKSAGLM
FT                   RVNVTKKLKYISTATVLMCGVMFFILSQQTEKSTERAKAEPAIRQALQAVDLGRYSIAS
FT                   DFYHKAIEFDPDRKEEFDRRINAMMDRRLQELWSGQYDFGKMRRYPEWEAARKADAFVQ
FT                   KEIQKFHRDFK"
     ttggatatga accgtatgac aatatcaatt ctgctcgttg tttctatttt aactttcaat        60
     tcagccttct tgtgtgcgga tagtaaattt cttgattctt caaaaacacc agaaaaagag       120
     atggactata agttcatagc accgaagacg acaatagaga caggagtaat aatgacaaaa       180
     gacggtcaaa atattgtagc tcgaaaaatt tctgaggata acaatgttat agtctattat       240
     ttagggcata tagcccatgg aataaccgta gacaaagtgt taagcattgc gaacacaagt       300
     ggatcgggac tgataggctt ttcagaaggt gatcggcgag atagtttgaa cggttctggt       360
     ttccaggctg aacccaagac gtctattaca aaagtagaaa atttggatga tgtaaatttt       420
     atcgatggag gaaaattttt tgaaaaagga aactatacag aagcgattca agcatatagt       480
     ttatatttga gatattaccc taaatcccca accggatatt caaatttggg tttatgttat       540
     ttacaaaagg gaaattttaa agaggctcta aagtaccata cgaaagcgat agagcttgat       600
     gacaatagag caaatctgta tatagcgaga agtgtttcat actggaaaat gggattaaat       660
     gaccttgctt ttgctgatat agaaaaagct attgagttaa atcccaataa caaggatgcc       720
     tatttaaaga aaggaaaatt cctgtttaat aaagaagaat acaaaaatgc tatcaaacca       780
     tttttaaaat atttggaatt gggaggcaat aactgggagg cactatcagc tttgggttgg       840
     gcatatcata aaaccgacaa tgacagagat gcactaaaat atttaatgat cgctcatcaa       900
     agtaacgagg gttcctatga taataatata aggatggccg acgtttacag ggggcttaag       960
     gaatatgaaa atgctataaa atattatacg ttggctttga atactgacaa aaaagatata      1020
     ttcctctatt tgtatagagg catatcttat atggaaaagg gagactattc gctagctgaa      1080
     ttggatttta aaaaagcact tgaattgaag gaaaatgatc ctgttgtatt gtgtaattat      1140
     gcacaacttt acatttatca agacaaagat agaaaagcga tacctttact taaaaaggtt      1200
     ttagaggtat cgaaagatga ggaatgtaat atttggtcga agtttaccct agaggaaata      1260
     tcaaaaagcc gtaaaaagac aagaaacgta attgcactct ttttaatttt tattgcatta      1320
     atttttttaa tattgttggg cgttttaaaa ctaaaaaaaa gtgcaggatt aatgagagta      1380
     aatgtcacaa aaaaattaaa atatatatcg actgcaactg ttcttatgtg tggtgtaatg      1440
     ttttttatac tgtctcaaca aacagaaaaa agtacggaaa gagctaaggc agagccagca      1500
     atacgacagg cacttcaggc cgttgattta ggtcggtatt ctatagcgtc agatttctat      1560
     cataaggcaa ttgaattcga tcctgaccgg aaagaagagt ttgatagaag aattaatgca      1620
     atgatggacc gtaggctaca agaactgtgg tctggtcaat atgacttcgg taaaatgaga      1680
     cggtaccctg aatgggaggc ggcacggaag gcagatgcgt ttgttcaaaa ggagatacaa      1740
     aaatttcaca gggattttaa ataa                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page