(data stored in ACNUC7421 zone)

EMBL: CP000859.PE277

CP000859.PE277       Location/Qualifiers
FT   CDS_pept        318150..319391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0277"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: pha:PSHAa2093 type I
FT                   restriction-modification system, S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66087"
FT                   /db_xref="GOA:A8ZS69"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS69"
FT                   /protein_id="ABW66087.1"
FT                   /translation="MKRYPKYKDSGVEWIGEVPEQWEVKRLKFLAKNVNEQTNTKKQDE
FT                   IYIALENVESWTGRISPQDNEITFESQAKCFCSNDILFGKLRPYLAKVARPNKSGVCVG
FT                   EFLVLRVLDNEVLPEFLEQKLRSQWFIELVNSSTFGAKMPRADWTFISNVKLTYPSPKE
FT                   QNHIASYLDHKTRLIDTLIEKKQKLVELLQEQRTALISHAVTKGLNPKTKMKDTGIEWL
FT                   GKVPEHWATASLRWYLRIGSGEFLSNNDFLTEASDQKNIPVIGGNGVMGYTSKTNIQEP
FT                   TIAIGRVGALCGNVHLVNPPAWITDNALRLSNIKDFLIDYLSLFLGVLDLNRLANQNAQ
FT                   PLITGSMIKSQKVPIPPIPEQKDILQYCSKFSQTIDHGINTLHKQIAVLQEYRTTLISD
FT                   VVTGKIDVRDEVIP"
     atgaaacggt atccgaagta taaggacagc ggggttgagt ggataggcga agtgccggaa        60
     cagtgggaag taaagcggtt aaaatttctg gctaagaatg tgaacgaaca gacaaacaca       120
     aaaaaacaag atgaaatcta tattgctctt gagaatgttg aaagctggac cggtcgtata       180
     agccctcaag acaatgaaat tacttttgaa agccaagcaa agtgtttttg ttccaatgat       240
     attttgtttg ggaagcttcg tccgtatctt gctaaagtag ctcggccgaa caaatccggt       300
     gtctgtgtcg gagaattcct tgtcctccga gttcttgaca atgaggtcct tcccgagttt       360
     cttgaacaaa agctacggtc acaatggttt attgagttgg tcaacagctc aacctttggt       420
     gcgaagatgc caagagcaga ttggacattc atcagtaatg tcaagcttac atatccatcg       480
     ccaaaagaac aaaatcatat cgcctcttac ctcgaccaca aaacccgcct catcgacacc       540
     ttgattgaaa agaaacagaa gctggttgaa ctgctccagg agcagcggac agcccttatc       600
     agccatgctg tcaccaaagg gctgaacccc aagaccaaga tgaaggatac cgggattgag       660
     tggctaggta aggtgccgga gcattgggca acagcatcgt taagatggta tttaagaatt       720
     ggcagcggag agttcctatc aaacaatgat tttctaactg aagcttctga tcagaagaac       780
     attccggtaa ttggtggtaa tggagtaatg gggtatacaa gcaagacgaa tattcaggag       840
     ccaacaatag caatcggacg ggtcggagct ctttgtggaa atgttcattt ggttaatcca       900
     cccgcctgga taactgataa tgctcttcgt ctttctaata ttaaggattt tctcattgat       960
     tacctttcat tgtttcttgg ggttttggat ttaaatagat tggctaatca aaatgcacag      1020
     ccactgataa cgggaagcat gataaaatca caaaaagttc ctattccgcc gataccagaa      1080
     cagaaagaca ttcttcagta ttgttctaaa ttttcgcaaa cgattgatca tggtataaat      1140
     acattgcaca agcaaatagc cgttttacaa gaataccgca ccactctaat atccgatgtg      1200
     gttaccggaa aaatcgatgt aagagacgag gtcatcccat ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page