(data stored in ACNUC7421 zone)

EMBL: CP000859.PE28

CP000859.PE28        Location/Qualifiers
FT   CDS_pept        29588..30250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0028"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sfu:Sfum_1732 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65838"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS1"
FT                   /protein_id="ABW65838.1"
FT                   /translation="MQHSDKNPMVVRQIKLSRMETFCYLVGDPASKTGLLIDPAFDTGR
FT                   ILAAAATAGFTITAVVNTHGHADHCCGNAAVMGASGARLHIHKKDARQLTGFFNGVLCR
FT                   LLGGRPSPRPDVVLQHGEAVVLGQTTLTVLHTPGHTPGSICLYMPGHLFAGDTLFVGSA
FT                   GRTDLSGGSIKDLHASIRTRLFPLPDDTRVWPGHDYGDRPVSTIGHEKKTNPFMQAD"
     atgcaacatt cagataaaaa cccgatggtg gtgcggcaga taaaactgtc ccgaatggag        60
     accttctgct acctggtggg ggacccggcc tccaaaaccg ggctgttgat tgacccggcc       120
     tttgacaccg gccggattct ggccgcggcc gcaaccgcgg ggtttaccat caccgccgtg       180
     gttaacaccc acggccacgc ggaccactgt tgcggcaacg cagccgtcat gggcgcttcc       240
     ggtgcccggc tgcatattca caaaaaagat gcccggcaac tgaccggatt ttttaacggc       300
     gttctgtgcc ggctcctggg gggccggccg tcgccccgtc ccgatgtcgt gttacagcac       360
     ggtgaagcgg tggtgctggg acagaccacc ctcaccgtgc tgcacacgcc gggccacaca       420
     ccaggcagca tctgcctcta tatgccgggc cacctgtttg ccggcgacac cctgtttgtc       480
     ggctccgccg gacgcaccga cctttccggc gggtcgataa aagaccttca cgcctccatc       540
     cgcacccgtc tttttcccct gcctgacgac acccgggtct ggcccggcca cgactatgga       600
     gaccggcccg tttccaccat cggccatgaa aaaaagacca atccgtttat gcaggccgat       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page