(data stored in ACNUC7421 zone)

EMBL: CP000859.PE282

CP000859.PE282       Location/Qualifiers
FT   CDS_pept        326227..327066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66092"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS74"
FT                   /protein_id="ABW66092.1"
FT                   /translation="MSRNLALQDFNQEIHISHNQIFTYCNCSLKYRFQYVEHRKPERVN
FT                   IALPFGSAIHAAIEMYYRTLKNHGHEESVTAICERFQTCLELDLDNTDVPVIFKKDLPD
FT                   RKAAVEMGHAMLRAFHENTVQTAQTAQQIVAVELPLTSTLYTEEGHATEYKLAGILDLV
FT                   LRDESGEIVVVDNKTAARPMAQGTANHDNQMTAYATLLASNRYVLPKAKVKCRFDILRK
FT                   LKKPKLEQVNTTRNAEQRKRFAKIANAVLAGIDAGIFLPQPSWMCGDCAYSNACREW"
     atgtcaagaa atctggcgtt acaggatttt aaccaggaaa tacatatcag ccataaccag        60
     atattcacct attgcaactg ttcccttaaa tatcgtttcc agtatgtcga gcaccggaaa       120
     cctgaacgag tcaacatcgc tttgccgttc gggtcggcga tacatgccgc tattgaaatg       180
     tattaccgga ccctcaagaa ccatggccat gaagagagtg tgacggctat ctgtgagcgt       240
     tttcagacct gtctggaact ggacctggac aacacggatg ttccggtcat tttcaaaaag       300
     gacctgccgg accggaaggc agccgtcgaa atgggccacg ccatgttgcg ggctttccat       360
     gagaacaccg tccagaccgc ccagaccgct caacagattg tcgctgttga actgcccctt       420
     accagcacgc tttacacgga agaagggcac gccacggaat acaagctggc gggcattttg       480
     gatttggtgc ttcgggatga gtccggtgaa attgtggtgg ttgacaacaa aacagcggcc       540
     aggccaatgg cacaaggcac cgcaaatcac gataaccaga tgacggccta cgcaacgctg       600
     ctcgcctcaa accggtacgt cctgcccaag gcgaaagtca aatgccgctt cgatatcctg       660
     cggaaactga aaaaacccaa gctggagcag gtaaacacca cacgtaacgc ggaacagcga       720
     aaacgcttcg ccaagattgc caatgccgtc ctggcaggaa ttgatgccgg catctttctg       780
     ccgcagccgt catggatgtg cggtgattgt gcttattcta acgcgtgcag agagtggtaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page