(data stored in ACNUC7421 zone)

EMBL: CP000859.PE283

CP000859.PE283       Location/Qualifiers
FT   CDS_pept        327183..328139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_2292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66093"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS75"
FT                   /protein_id="ABW66093.1"
FT                   /translation="MKTTTTTLERVIEKVHEASAGHYDEVVPVQEMEFDSLSRMWIAGQ
FT                   QTEILPGAQRLLSNRLRVPFSYLSRCPANLQAENLNFWIEQERLNRETFFCRFDGHRLR
FT                   AVFTERYKPLDNMDVLSQLLRHGFDPDTQVQYAIDDGMFLVRIPEYARAFGVNPGYGKL
FT                   DEIVPGVSFANSEVGLLAFSIEAFFYRLVCTNGLISKTSSTFSRFKHISNRGLENFPET
FT                   IAGVIEDSVRKQEQFKLSRQSPVENPIRSIETFARQFGLAHLETEVVCKAYLLEQGATM
FT                   FHIINAFTRAAQDKHLDTLQSYRLESAGGQILSLVRP"
     atgaagacaa caacaacgac tttggaaagg gtaatcgaaa aagttcacga agcatctgcc        60
     ggtcattatg acgaggtggt gccggtgcag gagatggaat tcgacagtct gtccagaatg       120
     tggattgcag gacagcaaac ggaaatcttg cccggtgccc agcggctctt gtccaacagg       180
     ctccgggtgc ctttttctta tctgtcccgc tgcccggcca acctgcaggc cgaaaatctg       240
     aatttctgga ttgaacagga acgactgaat cgggaaacct ttttctgccg gtttgatggg       300
     catcggctga gagccgtgtt taccgagcgg tataagcccc tggacaacat ggatgtgctt       360
     tcgcaactgc tccggcacgg cttcgaccca gacacgcagg ttcagtacgc tattgatgac       420
     ggcatgttcc tggtcaggat tccagagtat gccagagcct ttggcgtgaa tcccggatac       480
     ggcaaactgg atgaaatcgt gcccggcgtg tcgtttgcaa acagtgaagt cggcttgctt       540
     gcctttagca tcgaggcgtt cttttatcgg ctggtctgca ccaacgggct catttcaaag       600
     acatcatcga ccttttcccg ctttaaacat atcagcaacc gggggctgga aaactttccc       660
     gaaaccattg ccggtgttat cgaggattcc gtccggaagc aggaacagtt caagctgtcc       720
     cggcaatctc ctgttgaaaa tcctatccgt tctattgaga cctttgccag gcagttcggt       780
     ctggcccatt tggaaaccga agtggtctgt aaagcctatc tgcttgagca aggtgccacg       840
     atgtttcaca tcatcaatgc attcacacgg gcggcccagg acaaacacct ggacactttg       900
     caatcctatc ggctggaatc ggccggtggt cagattttaa gtttggttcg gccctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page