(data stored in ACNUC7421 zone)

EMBL: CP000859.PE288

CP000859.PE288       Location/Qualifiers
FT   CDS_pept        331373..332584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0288"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   prw:PsycPRwf_0726 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66098"
FT                   /db_xref="GOA:A8ZS80"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS80"
FT                   /protein_id="ABW66098.1"
FT                   /translation="MEDKLMAKKQDRYLQKRDNTFYFRKKHNGKVFKRSLNTTDKRTAR
FT                   DLRNFYLRNLVEYGQLDAPEKVDYDVITFGEVAKEWASIHKKEVRYSTWPDYVSSMNGH
FT                   ILPNFKDMPIAEITYGDVLKFRSGLKVGAKRANNILVPMKSVFDYADREGIIQDNVMRK
FT                   IKRLSEEAPEIHPFSYDEVNRLLDAVHPWYQPYLIVAFFTGMRAGEQNGLCWSDFLEDM
FT                   QPEPRIFIRKTYVYKKDGIPKTKKSKRYIKCLPQVLEALSEQRKLTGKNKHIFLTIDGR
FT                   RMTPDHIRKEVWIPALEKAGIEYRPPIQTRHTFATMMLSAGEDIGWVQNMLGHSSLQMI
FT                   FQRYYAWVPEKTRSDGHAFMKYVGCLSVTQKQDAGSAGEIKVKTDEGCTNLVPLDKYRH
FT                   KKRG"
     ttggaggata agctgatggc gaaaaaacaa gacaggtatt tgcagaagcg tgacaacacc        60
     ttttatttcc gtaaaaagca taatggcaaa gtgtttaagc gatcattgaa tacaactgac       120
     aagcggacag ctagggacct tcggaatttt tacctcagaa acctcgttga atacggacaa       180
     ctggatgcac ctgaaaaggt ggactatgat gtcatcactt tcggggaggt tgcgaaagaa       240
     tgggcttcca tacacaagaa agaggttcgg tattctacgt ggccggatta cgtgtcatca       300
     atgaacggtc atatcctgcc taatttcaaa gacatgccaa tagctgaaat cacctacgga       360
     gatgtgctga aattcagaag cgggttgaag gttggagcca aaagagcgaa caacatttta       420
     gtgccaatga aatctgtttt tgattatgct gatagggaag ggattattca ggataacgtg       480
     atgcggaaga taaaacgact ttcagaagaa gcaccggaga ttcatccttt ctcttatgat       540
     gaggtcaatc gacttctaga cgcagtgcat ccctggtatc aaccgtattt gattgtagcg       600
     ttttttacgg gcatgcgggc gggagagcaa aatggtctgt gttggtcaga ttttcttgaa       660
     gatatgcaac cagagccacg gatttttatc cgtaaaacgt atgtgtataa aaaggacggc       720
     atcccgaaga ccaaaaagtc aaagcgttat ataaagtgtc ttccgcaggt gcttgaggct       780
     ctatcggagc aacggaaact gaccggtaaa aataaacata tctttctgac cattgacgga       840
     agacggatga ccccggatca catccggaag gaggtatgga ttcccgcact agaaaaggcg       900
     ggtattgaat atcgtccgcc cattcagaca aggcatactt tcgctaccat gatgctttct       960
     gccggtgagg atattggttg ggtccagaac atgcttggac actcctcgtt gcagatgatt      1020
     ttccagcggt attatgcctg ggtaccggag aaaacccgtt cagacggtca tgcgttcatg      1080
     aagtacgttg gatgcctatc cgtaacgcaa aaacaggatg ccgggagtgc aggtgagata      1140
     aaggtaaaaa cggacgaagg gtgtaccaat cttgtaccac tggacaaata taggcataaa      1200
     aaaagaggct ag                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page