(data stored in ACNUC7421 zone)

EMBL: CP000859.PE290

CP000859.PE290       Location/Qualifiers
FT   CDS_pept        complement(333067..333672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0290"
FT                   /product="phosphoserine phosphatase/homoserine
FT                   phosphotransferase bifunctional protein"
FT                   /note="TIGRFAM: phosphoserine phosphatase/homoserine
FT                   phosphotransferase bifunctional protein; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: pau:PA14_41830
FT                   homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66100"
FT                   /db_xref="GOA:A8ZS82"
FT                   /db_xref="InterPro:IPR011863"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS82"
FT                   /protein_id="ABW66100.1"
FT                   /translation="MNIVCCDLEGVFVPEIWINVAKKTGIDELRLTTRDISDYDVLMKK
FT                   RLAILADHGLKLADIADVIATIDPLEGALEFLTWLRKQTQVIIVSDTFTQFAGPLMEKL
FT                   LLPTLFCNTLTIGDDGAIVDYNLRQKDGKRQTVLALRTLNYHITAMGDSYNDTGMLAEA
FT                   DLGILFRPPENVVREFPQFPVATDYDTVRELLADSLAK"
     atgaacattg tctgctgtga cctggaaggg gtgtttgttc cggaaatatg gatcaacgtg        60
     gccaaaaaga ccggcatcga cgaactcagg ctcaccaccc gggatatctc cgactatgac       120
     gtgctgatga aaaaacggct ggccattctg gcggaccatg gcctgaagct tgccgatatc       180
     gccgacgtga tcgccactat tgaccccctt gaaggcgccc ttgagtttct cacctggctg       240
     agaaaacaga cccaggtcat catcgtgtcc gacaccttca cccagtttgc cggccccctg       300
     atggaaaagc tgcttctgcc caccctgttc tgcaacaccc tgaccatcgg ggatgatggc       360
     gccatcgtgg actacaacct gcggcagaag gatggcaagc gacaaaccgt gctggccctt       420
     cgcacgctga actaccatat cacggccatg ggcgactcct acaatgacac cggcatgctt       480
     gccgaggccg acctgggcat tctgttccgg cccccggaaa acgtggtccg ggagtttccc       540
     cagtttcccg tggccaccga ttacgacacg gtgcgggagc tgctggccga ttccctggca       600
     aaatag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page