(data stored in ACNUC7421 zone)

EMBL: CP000859.PE293

CP000859.PE293       Location/Qualifiers
FT   CDS_pept        336565..337605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0293"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: gur:Gura_2153
FT                   phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66103"
FT                   /db_xref="GOA:A8ZS85"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS85"
FT                   /protein_id="ABW66103.1"
FT                   /translation="MSSLTYADAGVDIDKANALVDNIKKIAKQTRRQGVMGDIGGFGGL
FT                   FSLNLSDLKNPVLVSSTDGVGTKLKIAFMAGRHDTVGIDLVAMCVNDIAVQGAKPLFFL
FT                   DYMAVGKLNTEIATQVITGIGEGCKQAKCALIGGETAEMPGFYKDNEYDLAGFTVGIVE
FT                   SDAIIDGSNIHVGDAIIGIASSGLHSNGFSLVRKICFDVLKLKIDDHIDDLGKTLAEEL
FT                   LTPTIIYSETVHSLLKLFPIHGIAHITGGGLAENVVRVLPQACVATIRKGSWDVPPVFS
FT                   FLQKAGKVEDREMTRTFNNGIGLVVVVPAKKADDAMASIRAVGEKPFLIGEITPRKADE
FT                   PQVQLV"
     atgagttctc tgacctacgc ggatgccggc gtggatattg ataaagccaa cgcgcttgtg        60
     gacaacatca agaaaatcgc caagcagacc cggcggcagg gggtgatggg cgacatcggc       120
     gggttcggcg ggcttttctc cctgaacctg tcggacctga aaaatcctgt gctggtcagc       180
     tccaccgacg gtgtgggcac caagctgaag atcgccttta tggcgggccg gcacgatacc       240
     gtgggcatcg accttgtggc catgtgcgtc aacgatattg ccgtccaggg cgcaaaaccg       300
     ctcttttttc tggactacat ggccgtggga aagctgaata cagagatcgc cacccaggtg       360
     atcaccggca tcggagaggg atgcaaacag gccaaatgcg ccctgatcgg cggtgaaacc       420
     gctgaaatgc cgggttttta caaagacaac gagtatgacc tggccggttt taccgtgggc       480
     atcgtggaga gcgacgccat tattgacggg tccaacattc acgtgggcga cgccattatc       540
     ggcatcgctt ccagcgggct gcacagcaac ggtttttctc tggtccgcaa gatatgcttt       600
     gacgtgctga agctcaagat tgacgatcat atcgacgatc tgggcaaaac cctggccgag       660
     gagctgttga cccccactat catttattcg gagacggttc acagcctgct caagctcttt       720
     ccgattcacg gcatcgccca tatcaccggc ggcggtctgg ccgaaaacgt ggtccgggtg       780
     ctgccccagg cctgcgtggc caccattcga aaaggatcat gggacgtgcc tccggtcttt       840
     tcttttttgc aaaaggcagg aaaggtcgaa gaccgcgaga tgacccgcac ctttaacaac       900
     ggcatcggcc tggtggtggt ggtgcccgcg aaaaaagccg acgatgccat ggcaagcatt       960
     cgggccgtgg gggaaaagcc gtttctgatc ggtgagatca cccccagaaa agcggatgaa      1020
     ccccaggtgc aactggtgta a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page