(data stored in ACNUC7421 zone)

EMBL: CP000859.PE295

CP000859.PE295       Location/Qualifiers
FT   CDS_pept        complement(339512..340543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0295"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: tte:TTE0215 Beta-glucosidase-related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66105"
FT                   /db_xref="GOA:A8ZS87"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS87"
FT                   /protein_id="ABW66105.1"
FT                   /translation="MAATDKRPFSLSGFSDDMLAGQRLVAGFEGTTLNDDLKYLIDTLK
FT                   VGGIILFAVNLEHPDQIRDLCASAQAHAAACRLPPLFVAIDQEGGQVARLKPPFTRFEG
FT                   NPSITTDDQARHFARITASELAGIGVNMNMAPVLDVADGVTDSVMAGRAFAGGPREVAR
FT                   LGGVVIEEMQKNGIMAVGKHFPGIGRTTADSHIDQPWLAADPAEMETTDLVPFKTAIER
FT                   DVAGIMLSHIRYTALDPDLPASMSTPIAKTLLREKLGYEGLVMTDDLDMGAIRNHHVMD
FT                   QVVRCADRAGIDMVLVCHKGPDRKKAVESFRELLETSDTHRKQALCSVERILRAKARYL
FT                   CRI"
     atggcagcaa ccgacaaacg ccctttttcc ctctccggct tttccgatga catgctggct        60
     ggccagcggc ttgtggccgg atttgaggga acaaccctca acgacgacct caaatacctg       120
     atcgacaccc tcaaggtggg gggtattatt ctgtttgccg tgaacctgga gcaccccgat       180
     cagattcgcg acctgtgcgc ttcggcccag gcccatgccg cggcctgccg cctgccgccc       240
     ctgtttgtgg ccatcgacca ggaaggggga caagtggccc ggctcaaacc gccctttacc       300
     cggtttgagg gcaacccttc aatcaccacg gatgaccagg cccggcactt cgcccgaatc       360
     accgcgtccg agctggccgg catcggggtg aatatgaaca tggcgccggt gctggacgtg       420
     gccgacgggg ttaccgacag cgtcatggcc ggccgggcct ttgccggcgg cccccgggaa       480
     gtggcccggc tgggcggcgt ggtcattgaa gagatgcaga aaaacggcat aatggccgtg       540
     ggcaagcact ttcccggcat cggccgcacc acggccgact cccacatcga ccagccctgg       600
     ctggcggccg atcccgcaga aatggaaacc accgacctgg tgccgtttaa gacggccatc       660
     gaacgggacg tggccggcat catgctttcc catatccgct acaccgccct ggatccggac       720
     ctgccggcca gcatgtcgac acctattgca aaaaccctgc tgcgggaaaa attgggatat       780
     gaaggcctgg tgatgaccga cgatctggac atgggcgcca ttcgcaacca ccatgttatg       840
     gatcaggtgg tgcgatgcgc ggaccgggcc ggcatcgaca tggtgctggt ctgccacaag       900
     gggccggaca gaaaaaaggc ggttgagtcc ttcagggaac tgctggaaac atcggacacg       960
     cacagaaaac aggccctgtg ctcagtggag cggattctgc gggccaaggc ccgttatctt      1020
     tgccgcattt ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page