(data stored in ACNUC7421 zone)

EMBL: CP000859.PE300

CP000859.PE300       Location/Qualifiers
FT   CDS_pept        344402..345388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0300"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="KEGG: dvu:DVU3143 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66110"
FT                   /db_xref="GOA:A8ZS92"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS92"
FT                   /protein_id="ABW66110.1"
FT                   /translation="MPDTISRRNFLKAGLITAGAVAASGTGLASMAGAASGEPLCTLLD
FT                   LSRCIGCEECVYACREVNGHKFPELKGAIPEMIPREKVKIADWSAPEKQAVSDRLTPYN
FT                   WLYIQRAYGEHNGEPFELNIPRRCMHCENPPCSKLCPFGAAYQQDNGIVAISPDICMGG
FT                   AKCKAVCPWHIPERQSGVGLHLNLMPQYAGNGVMYKCDRCFDRVAEGELPACIEVCPVD
FT                   VQQIGPKSRIIEKARQLAKETNGFIYGLEENGGTNTIYVSPVPFDVLNGSVEKGPGKPH
FT                   LQPVADAMTTPNRMFAALAIAPVAGIVAAVARFGLLAGNKDHEKENM"
     atgcccgaca ccatttccag gcgtaatttt ttaaaggccg gtctgatcac ggccggggcc        60
     gtggccgcct cgggcacggg cctggcctcc atggcggggg ctgcttccgg tgagcccttg       120
     tgcaccctgc tggacctgag ccggtgcatc ggctgcgaag agtgcgtgta tgcctgccgg       180
     gaggtcaacg gccacaagtt cccggagctc aagggcgcca ttcccgagat gattcccagg       240
     gaaaaggtaa agatcgccga ctggtcggcc ccggaaaaac aggccgtttc cgaccggctc       300
     accccctaca actggctcta cattcagcgg gcctacggtg aacacaacgg cgaacccttt       360
     gagctcaaca ttccccggcg gtgcatgcac tgcgagaacc cgccctgctc caagctctgt       420
     ccctttggcg cggcctacca gcaggacaac ggcatcgtgg ccatctcccc ggacatctgc       480
     atgggcgggg ccaagtgcaa ggcggtctgt ccctggcaca ttcccgaacg ccagtccggg       540
     gtggggcttc acctgaacct gatgccccag tacgcgggca acggggtcat gtacaagtgc       600
     gaccggtgct ttgaccgggt ggccgaaggt gagctgcccg cctgcattga ggtttgtcct       660
     gtggatgttc agcagatcgg gccgaaaagc cggatcattg aaaaggcaag acagctggca       720
     aaggagacca acgggtttat ctacgggctg gaggaaaacg gcggcaccaa caccatttat       780
     gtgtcaccgg tgccttttga tgtgctaaac ggatcggtgg aaaaaggacc gggcaaacct       840
     cacctgcaac cggtggccga tgccatgacc acgcccaacc ggatgtttgc ggccctggcc       900
     attgcgccgg tggccggtat tgtggcggcc gtggcccggt tcggactgct ggccggcaac       960
     aaagaccatg aaaaggagaa catgtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page