(data stored in ACNUC7421 zone)

EMBL: CP000859.PE302

CP000859.PE302       Location/Qualifiers
FT   CDS_pept        complement(346015..347349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0302"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: dde:Dde_3709
FT                   ferredoxin, 4Fe-4S, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66112"
FT                   /db_xref="GOA:A8ZS94"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS94"
FT                   /protein_id="ABW66112.1"
FT                   /translation="MAETAEKEKKVIIDEGLDTGARRLTPERIKTVYNKMLGKAMGAKV
FT                   RTYVDTCVHCGLCSDACHVYLSNDKDPKYSPAGKVKRTLGELIKKKGNVSPDFIKEMSE
FT                   IASTECNVCKRCAMYCPFGIDVAYLMLVARRFCHLCGVTPLYIQATAHSHAATMNQMWV
FT                   KEDEWIDTLQWQEEDGREEMPNLRIPLEKEGAEIMYSVIGPEPKFQPTLIYNAAIIMNT
FT                   AGLDWTMPATPGWDNSDMAMYTGDNEIMGRVKRAHFEAAARLKVKKIVMGECGHAFRSV
FT                   YDMGNRQLGWKMPPIPIVHAIEFYYDLLKSGKIKIKEKYKKSVTLHDPCNVVRGRGLHE
FT                   KARYVVNQICENFIEMHPNREHNYCCNAGGGVINCGPPFKNKRVISNSVKAKQIADTGA
FT                   EILITPCHNCHSGMEDIISYYEVGMHTKFLSEIIYEVMEKPEPAE"
     atggccgaaa cagctgaaaa agaaaaaaaa gtcataatag acgaggggct tgataccgga        60
     gccaggcgac tgaccccgga acggattaaa accgtatata acaaaatgct gggcaaggcc       120
     atgggcgcca aggttcgcac ctacgtggac acctgcgttc actgcggcct ttgttcggat       180
     gcctgccatg tctacctgtc caacgataaa gatcccaagt attcaccagc cggaaaggtg       240
     aagcggaccc ttggggaact catcaagaaa aaaggcaacg tctctccgga tttcatcaag       300
     gagatgtcgg agatcgcctc caccgagtgt aacgtctgca agcggtgcgc catgtactgc       360
     ccctttggta tcgacgtggc ctacctgatg ctggtggccc gtcgcttttg ccacctgtgc       420
     ggggttaccc ccctgtacat tcaggccacg gcccacagcc atgccgccac catgaaccag       480
     atgtgggtaa aagaggatga gtggatcgac acccttcagt ggcaggagga ggacggtcgc       540
     gaagagatgc ccaacctgcg gattccgctg gaaaaagagg gtgccgagat catgtactcc       600
     gtgatcggcc cggagcccaa gttccagccc accctgatct acaacgccgc cattatcatg       660
     aacacggcgg ggcttgactg gaccatgccg gccaccccgg ggtgggacaa cagcgacatg       720
     gccatgtaca ccggcgacaa cgagatcatg ggccgggtca aacgggccca tttcgaggcg       780
     gcggcccggc tcaaggtcaa aaaaatcgtc atgggcgagt gtggccatgc cttccgctcg       840
     gtctatgata tgggcaaccg gcagctcggc tggaaaatgc cgcccattcc gattgtgcac       900
     gccatcgaat tttactatga cctgctcaaa tccggtaaaa taaagataaa agaaaaatac       960
     aaaaaatcgg tcaccctgca cgacccctgc aacgtggtcc ggggccgggg cctacatgaa      1020
     aaggcccggt acgtggtcaa ccagatatgt gaaaacttca tcgagatgca ccccaaccgt      1080
     gagcacaact actgctgcaa cgccggcggc ggggtgatca actgcggccc tccctttaag      1140
     aacaagcggg tgatcagcaa ttcggtcaaa gccaagcaga tcgccgacac cggagctgaa      1200
     attttaatca cgccctgcca caactgccac agcggcatgg aggatatcat cagctactac      1260
     gaggtcggca tgcacaccaa gttcctctcc gagatcatct acgaggtgat ggaaaaaccc      1320
     gagcccgccg agtag                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page