(data stored in ACNUC7421 zone)

EMBL: CP000859.PE303

CP000859.PE303       Location/Qualifiers
FT   CDS_pept        complement(347399..348076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_3708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66113"
FT                   /db_xref="GOA:A8ZS95"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS95"
FT                   /protein_id="ABW66113.1"
FT                   /translation="MNTPDTFDVIYNFVSGPLVWAAFILFVGGSIYRLWKMLALVNKKD
FT                   RFIFTYMSLYHSLRSIAHWIVPFGTTSWRMHPVMTVATFAFHICLLVLPIFLAGHVVMI
FT                   AFSWGVSWPTLPAGVVDVMTVIVIACCIFFLVRRIVQKEVKYLTTPSDYVLLLITAAPF
FT                   VTGFFAYHQWLDYRTWILLHILSGEIMLVAIPFTRLSHMLFAVFTRSYIASEFGGVRCA
FT                   KDW"
     atgaacactc cggatacctt tgacgtcata tacaattttg tcagcggccc ccttgtgtgg        60
     gcggccttta tcctgtttgt cgggggcagc atctaccggc tctggaaaat gcttgccctg       120
     gtcaacaaaa aagaccggtt catctttacc tacatgagcc tgtatcacag cctgcgctcc       180
     atcgcccact ggatcgtccc ctttggcacc accagctggc gcatgcaccc ggtcatgacc       240
     gtggccacct ttgcctttca catctgcctg ctcgtgctgc cgatctttct ggccggccac       300
     gtggtgatga tcgccttttc ctggggcgtg agctggccca ccctgccggc gggggtagtg       360
     gatgtgatga ccgtaatcgt gatcgcctgc tgcatcttct ttctggtacg cagaatcgtg       420
     caaaaagagg tcaagtacct gaccaccccg tcggactatg ttctgctgct gatcacggcg       480
     gccccgtttg tcaccggttt ttttgcctat caccagtggc tggactaccg cacatggatc       540
     ctgcttcaca ttctttccgg agagatcatg ctggtggcca ttccctttac ccggctgagc       600
     cacatgctgt ttgccgtgtt cacacgttcc tacatcgcct ctgaattcgg cggggtacgg       660
     tgtgcaaaag actggtaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page