(data stored in ACNUC7421 zone)

EMBL: CP000859.PE306

CP000859.PE306       Location/Qualifiers
FT   CDS_pept        350375..351739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0306"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   C subunit; PFAM: 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; Respiratory-chain NADH dehydrogenase domain
FT                   51 kDa subunit; KEGG: cbe:Cbei_2449 electron transport
FT                   complex, RnfABCDGE type, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66116"
FT                   /db_xref="GOA:A8ZSV2"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV2"
FT                   /protein_id="ABW66116.1"
FT                   /translation="MGLKLAGFEGSGTFAKGVHPPGHKNFSQDVPIEVVPTPAKVVVPL
FT                   MQNIGAPSECVVKAKQDVTFGEMIAKATGFVSVPIHSPINGKVQKVLNVTLPNGRHVPA
FT                   VPIKADGDQLEGAALMEEILGGDWPKDAADKHDPKAISEAISAAGIVGLGGAAFPTHVK
FT                   IMPNDKRPVDALLINGCECEPFLTPDYRIMVEAADAVICGALLAGRAVGAKQIVVGIEA
FT                   NKPKAVEAMTRAAQGTAVKIAVLKTKYPQGSEKHLIMAVMKRKVPPGKLPLEVGAAVSN
FT                   VGTVVAVARAVLRKKPLTHRVVCVTGGGIVQPKNLLVPIGISYGELIEFCGGLRPEAAR
FT                   IVSGGPMMGFAFTDMEMPVTKGASGVTVLTRDDVKKAEETACVRCGRCVDVCPLNLVPS
FT                   KLAVASRNKNLEVAERYNIFTCLECGCCAYTCPASLPLVQLIRMGKAAIMATRKK"
     atggggctga aattagcagg ctttgaaggc agcggcacct ttgcaaaggg tgtccacccg        60
     ccgggccata aaaacttttc acaggatgtg ccgattgagg tggtgccgac cccggcaaag       120
     gttgtggtgc cgctgatgca gaacatcggc gcgcccagcg aatgcgtggt caaggccaag       180
     caggacgtga cgttcggtga gatgatcgcc aaggccaccg ggtttgtgtc ggtgccgatt       240
     cattcgccca tcaacggcaa ggtacaaaaa gtattaaacg tgacccttcc caacggacgc       300
     catgtgccgg cagtgcccat caaggccgac ggcgaccagc tggaaggcgc ggccctgatg       360
     gaagagattc tgggcgggga ctggcccaaa gacgcggcgg acaagcatga ccccaaggcc       420
     atttccgagg ccatttccgc ggcgggcatc gtggggctcg gcggtgccgc ctttcccacc       480
     catgtaaaaa tcatgcccaa cgacaagcgg cccgtggacg ccctgctgat caacggctgc       540
     gaatgcgaac cctttctgac accggactac cggatcatgg tggaagcagc ggacgccgtg       600
     atatgcggcg cgctgctggc cggccgggcc gtgggcgcaa aacagattgt ggtgggcatc       660
     gaggccaaca agcccaaggc cgtggaggcc atgacccggg cggcccaggg aaccgccgta       720
     aagatcgcgg tgctgaaaac caagtatccc cagggcagtg aaaaacacct gatcatggcg       780
     gtgatgaaac gaaaagtacc gcccggaaag ctgcccctgg aagtgggagc cgcggtcagc       840
     aacgtgggca cggtggtggc cgtggcccgg gccgtgctcc ggaaaaagcc cctgacccac       900
     cgggtggtgt gcgtcaccgg cggcggcatc gtgcagccca agaacctgct ggtgcctatc       960
     ggcatcagct acggtgaact gattgagttc tgcggcggac tgaggcccga agcggcccgc      1020
     atcgtctccg gcggccccat gatggggttt gcctttaccg acatggagat gccggtcacc      1080
     aagggcgcca gcggcgtgac cgtgctgacc cgggatgatg tgaaaaaagc cgaagagacc      1140
     gcctgtgtcc gttgcggccg gtgcgtggat gtgtgtcccc tgaacctggt gcccagcaag      1200
     ttggccgtcg ccagccggaa taagaacctg gaagtggcgg agcgatacaa tatctttacc      1260
     tgcctggagt gcggctgctg cgcctacacc tgtccggcca gcctccccct ggtccagctg      1320
     atccgtatgg gcaaggcggc tatcatggcc accaggaaaa aataa                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page