(data stored in ACNUC7421 zone)

EMBL: CP000859.PE311

CP000859.PE311       Location/Qualifiers
FT   CDS_pept        354914..355825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0311"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   B subunit; PFAM: 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; Fe-S cluster domain protein; KEGG:
FT                   cbh:CLC_0431 electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66121"
FT                   /db_xref="GOA:A8ZSV7"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV7"
FT                   /protein_id="ABW66121.1"
FT                   /translation="MSAVTIGLAAGTLVGMAVILTYILGWANVAFYVEVDPRVDAVSKA
FT                   LPGANCGGCGFVGCGEYAEAVVMQGAPVNKCAPGGANCAAAIAQIMGVEVGEALPYRPI
FT                   VHCGAHTKDKHGISDYRGEQRCVTANIVADVQGCTYGCLGFGDCVEACAYDAIHVINGL
FT                   AVVDYTACVGCGACAKACPRNIITMTPFKADRVFAVLCSNKDAGKEVKKVCDVGCLGCK
FT                   ACERACGLFAIKDNLSCINYDDYDPEHLEDIFKAIDKCPQKGIVLVGKPSEKDMAAVAD
FT                   KEAPSVVTPDFKTTVDDTEWRG"
     atgtcggcgg taaccatcgg actggcagcc ggaaccctgg tgggaatggc ggtgatattg        60
     acctacatac tgggctgggc caacgtggcc ttttatgtgg aggtggaccc ccgggtggat       120
     gcggtttcca aggcccttcc cggcgccaac tgcggcggct gcggctttgt ggggtgcggc       180
     gagtatgccg aagcggttgt gatgcaggga gctccggtga acaagtgcgc cccgggcggc       240
     gccaactgcg cggcggccat tgcccagatc atgggcgtgg aggtgggcga ggccctgcct       300
     taccggccca ttgttcactg tggcgcccac acgaaagaca agcacggcat cagcgactac       360
     cggggtgagc agcgctgcgt caccgccaac atcgtggccg atgttcaggg ctgcacctac       420
     ggctgcctgg ggttcggcga ctgtgtcgag gcctgtgcct atgacgccat tcatgtgatc       480
     aacggcctgg ccgttgtgga ctataccgcc tgcgtgggct gcggggcctg tgccaaggcc       540
     tgcccgcgca acatcatcac catgaccccg ttcaaggcgg accgggtgtt tgccgtactc       600
     tgttccaaca aggacgcggg caaggaagtc aagaaggtct gcgacgtagg ctgcctgggg       660
     tgcaaggcgt gcgagcgggc ctgtggcctg tttgccatca aggacaatct ttcctgcatc       720
     aactacgacg attacgatcc tgagcacctg gaagatattt tcaaggccat tgacaaatgc       780
     ccgcagaagg gcatcgtgct ggtgggaaaa ccctctgaaa aagacatggc cgcggtggcg       840
     gacaaagagg ccccgtcggt tgtcacgccg gacttcaaga ccacggtgga cgacaccgag       900
     tggcgcggat aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page