(data stored in ACNUC7421 zone)

EMBL: CP000859.PE316

CP000859.PE316       Location/Qualifiers
FT   CDS_pept        362111..362950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0316"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   mta:Moth_1518 oxidoreductase FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66126"
FT                   /db_xref="GOA:A8ZSW2"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW2"
FT                   /protein_id="ABW66126.1"
FT                   /translation="MFKIVKRQEMAQGTVVLNEIEAPLIAAKAKPGQFVILKANETGER
FT                   IPLTMADTDPEKGTITIIFMIVGKSTALFATLKEGDAYMDVIGPLGAPTHIEKLGKVIC
FT                   VGGGTGVAVLHPITRALKEAGNHVFCVIGARNKDLLILEEQMKAASSDLRVCTDDGSYG
FT                   HHGFVTDVLKSILTENNDIKLVVAIGPVPMMKACSNLTKEFGVKTMVSLNPIMVDGTGM
FT                   CGGCRVSVGGETKFACVDGPEFDGHQVDFDELALRLRAYTADEKESHACFLNKAKQG"
     atgtttaaaa tcgtaaaacg acaggagatg gcccagggca cggtggtgct caacgagatc        60
     gaggcccccc tgatcgcggc caaggcaaag ccgggacagt ttgtgattct caaggccaac       120
     gagaccggag agcggattcc cctgaccatg gccgacaccg acccggaaaa gggcaccatc       180
     accattattt tcatgatcgt gggcaagagc acggccctgt ttgccacgct taaagagggg       240
     gacgcctaca tggacgtgat cggtcccctg ggggccccca cccacattga aaagctgggc       300
     aaggtgatct gcgtgggcgg cggcaccggc gtggccgtgc ttcatcccat cacccgggcg       360
     ttaaaagagg cgggcaacca tgtgttctgc gtcatcgggg cgcgcaacaa ggatctgctg       420
     attttggaag agcagatgaa ggcggcgtcc tccgacctgc gggtctgcac cgacgacggt       480
     tcttacgggc accacgggtt tgtcactgac gtgctgaaga gcattctcac agagaacaac       540
     gatatcaagc tggtggtggc catcgggccg gtgcccatga tgaaggcctg ctccaacctg       600
     acaaaggagt tcggggtcaa gaccatggtg agcctgaatc ccatcatggt ggacggtacc       660
     ggcatgtgcg gcgggtgccg ggtgtcggtg ggcggcgaga ccaagtttgc ctgtgtggac       720
     ggcccggaat ttgacggcca ccaggtggat tttgacgagc tggcgttgcg gctgcgggcc       780
     tatacggcgg acgaaaaaga gagccacgcc tgttttttga ataaagcaaa gcaaggataa       840
//

If you have problems or comments...

PBIL Back to PBIL home page