(data stored in ACNUC7421 zone)

EMBL: CP000859.PE323

CP000859.PE323       Location/Qualifiers
FT   CDS_pept        368475..369113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0323"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   aba:Acid345_3544 transcriptional regulator, CadC"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66133"
FT                   /db_xref="GOA:A8ZSW9"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW9"
FT                   /protein_id="ABW66133.1"
FT                   /translation="MACVLPVGPAGASPDGDRTLAILPFENNSVTTPETYDPLKSGLSV
FT                   MLMTELANSEAAFTLVEREKIRALLDEITLGQTGVIDASTAVKMGKMLGAQAIGFGAFM
FT                   VMGKNVRIDMRMVEVETGALIMAESITGKTDDFFTLERDLAQKIAGSMQAKEAVAQASS
FT                   KSSIEAALLFARGVDALESGDGRGADAFFKKAIKLDKSYQPQVDRLKGL"
     atggcgtgtg tgctgcctgt tggtccggca ggcgcgtccc cggacgggga tcggaccctt        60
     gccattctgc cctttgaaaa taactccgtc accaccccgg agacttatga cccgttaaaa       120
     agcggcctgt ccgtgatgct gatgaccgag ctggccaaca gcgaggcagc gtttacgctg       180
     gtggagcggg aaaagatccg tgccctgctt gacgagatca cccttggcca gaccggggtc       240
     attgacgcgt ccacggccgt gaaaatgggc aagatgctcg gggcccaggc cattggtttc       300
     ggggccttta tggtgatggg caaaaatgtc cgcatcgaca tgagaatggt cgaggtggag       360
     accggggcgc tgatcatggc cgagtccatc accggaaaga ccgacgattt ttttaccctt       420
     gagcgggacc tggcgcaaaa gatcgccgga tccatgcagg ccaaggaagc ggtagcccag       480
     gcaagctcca aaagcagtat tgaggcggca ttgctctttg cccggggcgt ggacgccctg       540
     gagtcgggtg acggccgggg ggcggacgcc tttttcaaaa aagcgatcaa gctggacaag       600
     tcttaccagc cgcaggtgga ccggttgaaa gggttgtaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page