(data stored in ACNUC7421 zone)

EMBL: CP000859.PE325

CP000859.PE325       Location/Qualifiers
FT   CDS_pept        370335..371519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0325"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: psa:PST_3859 GGDEF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66135"
FT                   /db_xref="GOA:A8ZSX1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX1"
FT                   /protein_id="ABW66135.1"
FT                   /translation="MIALAIIILLWADGTRESVLRFSETIFIATLVPALFFSLRLGRSN
FT                   HFFTVLVLAGLAGAAALLVPATFSSATAQQRFYYHAAAVLAPLHFVLFAWWHERGLLNM
FT                   WGLSRLIWIGLVPAAAAAACRVPDIIHHPGLARFVFHRALSGFPDVPLVPLIAALLALM
FT                   LLLVMYLRDPSPARDGFFWATAIVSAGFLFQKGPVVLQLAASGAIVVLLVSMVETGHFF
FT                   AYRDELTGLPSRRALNEKLQALGRTYTIAMVDVDHFKRFNDRYGHDVGDEVLKKVAAAL
FT                   KRAGGNAYRFGGEEFTLVFPGKALAQGKAAAEAARNAVSRSAFTIRSPARKKKDGSAPE
FT                   KATPGKRKRVSVTVSIGLAQRSSRHTTPDAVIKAADRALYRAKKNGRNRTETAP"
     atgattgccc tggcaatcat catactgctg tgggcggacg gaacccgtga atctgtttta        60
     cggttttccg aaacgatttt tattgccacg ctggtgccgg ccctgttttt ttccctgcgg       120
     ctgggcagaa gcaaccattt tttcacggtc cttgtgctgg ccggcctggc cggggccgcg       180
     gcccttctgg tgccggccac tttttcgtcc gccacggccc aacagcggtt ttattatcat       240
     gcggcagccg tcctggcacc gctgcatttc gttctgttcg cctggtggca tgagcggggc       300
     cttctcaaca tgtgggggct ttcccgcctg atctggatcg gcctggtgcc cgcggccgcg       360
     gcggccgcct gcagggttcc cgacatcatc catcaccccg gcctggcacg gtttgttttt       420
     caccgcgcgc tttcaggatt cccggatgtt cccctggttc ccctgattgc agccctgctg       480
     gccctgatgc ttctcctggt catgtacctg cgtgacccct ctccggcccg ggacggtttt       540
     ttctgggcaa cagcaattgt atccgccggt tttctctttc agaaaggccc tgtggtgctt       600
     caactggcgg cctccggggc cattgtggtg ctgctggtct ccatggtgga aaccgggcac       660
     ttttttgcct accgggacga gctgaccggc ctgccgtccc gcagggccct gaatgaaaag       720
     ctgcaggccc tgggtcggac ctacaccatt gccatggtgg atgtggatca tttcaagcgg       780
     tttaacgacc ggtacggcca tgacgtgggc gacgaggtgc tgaaaaaggt ggccgcggcc       840
     ctcaaaagag ccgggggaaa cgcctaccgg ttcggcgggg aggagtttac ccttgttttt       900
     ccgggaaaag ccctggccca gggaaaagcg gcggcggaag cagcccggaa cgcggtgagc       960
     cggtccgcct ttaccattcg aagcccggcc cggaagaaaa aagacggcag cgccccggaa      1020
     aaggcaacgc cgggaaagcg aaagcgcgtg tctgtaacgg tcagcatcgg cctggcccag      1080
     cggtcgtcac gccacaccac ccccgacgcc gtgatcaagg cggcggaccg ggccctttac      1140
     agggccaaga agaacggccg caaccgaacc gaaaccgccc catga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page