(data stored in ACNUC7421 zone)

EMBL: CP000859.PE330

CP000859.PE330       Location/Qualifiers
FT   CDS_pept        complement(379659..380639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ang:An01g09380 hypothetical protein Pfam:
FT                   Extensin_2 Troponin"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66140"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX6"
FT                   /protein_id="ABW66140.1"
FT                   /translation="MMRVRKNLIICLVCVCLAAGVGCKKGADNPPEQAEPARQTISMEQ
FT                   PAPAPPAEQPTAPEVMVVEEEAPGPMVVTGTPQVPAETTPPASGPATETEPVAKKAAEG
FT                   PSAEEQQAPSDMPPTPAEEPPAPPVEAVSDSPALTDTADPEETDIALPTSEVEAGAGTV
FT                   DGTAMETTDEMEEAPADDVASEIKIVIDLMGEEDLDAEEAAKTTAENQALAMFSPFTPL
FT                   FQKDASEDDMFLEQDSQRKRAFLTPLERISLGQLQLSGIIRAASGNRAIVTDATGKGYV
FT                   VKKGTYIGLNSGQVEEIVDDRVIVVEMVGGRRAVTELKLQKPAGE"
     atgatgcgcg tgcgtaaaaa ccttattatc tgtttagtgt gtgtctgcct ggcggcgggt        60
     gtgggatgca agaagggggc tgacaacccc ccggagcaag ccgagcctgc gcggcagacc       120
     atttccatgg aacagccggc gccggccccc ccggcggaac aaccgacagc gcctgaggtg       180
     atggttgttg aagaggaggc tccgggacca atggtggtga caggcacgcc gcaggttccg       240
     gccgaaacaa cgcccccggc atccggaccg gcaacagaaa cagaaccggt ggcaaaaaag       300
     gcggccgaag ggccttcggc cgaggagcag caggcaccgt ccgatatgcc gcccacacct       360
     gctgaggagc cgccggcccc accggtggaa gccgtttccg attccccggc gctgacggat       420
     acagccgatc cggaagaaac ggatatcgcc ctgccgacat cggaagtgga agcaggcgcg       480
     ggaacagtgg atggcactgc catggaaaca acggatgaaa tggaagaagc gcctgctgac       540
     gacgttgcgt ctgaaatcaa aatcgtgatc gacctgatgg gagaagagga ccttgatgct       600
     gaagaagccg ccaagacaac ggccgagaac caggcgctgg ccatgttcag cccgtttact       660
     ccccttttcc agaaagacgc aagcgaagat gacatgtttc tggaacagga ctcccagcgg       720
     aaacgggcct ttttaacccc cctggagcga atcagcctgg gccagttaca actgtccggc       780
     atcatccggg ccgccagcgg caaccgggcc attgtgaccg acgccacagg caagggatat       840
     gtggtcaaaa aaggtaccta catcgggctg aattccggcc aggtggaaga gattgtggat       900
     gatcgcgtga ttgttgtaga gatggtcggc ggacgcaggg ccgtaaccga attgaaactt       960
     cagaaaccag ctggagaata g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page