(data stored in ACNUC7421 zone)

EMBL: CP000859.PE333

CP000859.PE333       Location/Qualifiers
FT   CDS_pept        complement(381822..382877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0333"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   afw:Anae109_0686 type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66143"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX9"
FT                   /protein_id="ABW66143.1"
FT                   /translation="MLFGKKDHLVGLDIGSSVVKVAEVAVSSSGRSLLRFGTLEMPAGA
FT                   IVEEGIKDPEVVAATIKELFSLYNIKEDRVAISIGGYSVIVKKINVQSMSEEQLQEVIA
FT                   VEAEQYIPFDINNVNLDFQILGDNDQNPNQIDVMLVAAKKETVNDYLNVIDIAGLTPVI
FT                   IDVDAFALQNIYEVNYEAEENCVALIDIGANKTSLNILKGSKSVFMRDVSFGCNQINHH
FT                   IATKINCSLEEAEELKLSDKQERISTDELNSIISSVVSDWTTEIRRALDFFYSTYSNDH
FT                   LKCIYLSGGGSNIPEFRQMLASQTSSELEILNPFSNFDVKDDRLDSAYLKQIAPQAAIC
FT                   MGIAIRRVDDK"
     atgcttttcg gaaaaaagga tcatctggtg gggcttgaca tcggctccag cgtggtcaag        60
     gtcgcggagg tggccgtctc ctcctctggt cgaagcctgc tgcggttcgg caccctggaa       120
     atgccggcag gcgccattgt ggaggagggc atcaaggatc cggaggtggt ggccgccacc       180
     ataaaagagc ttttttcact ctataatata aaggaagacc gggtggcgat ctccatcggc       240
     ggatactcgg taattgtcaa aaagatcaac gtgcagagca tgagtgaaga gcagcttcag       300
     gaagtgatcg ccgttgaggc ggagcagtat atcccttttg acatcaacaa cgtgaatttg       360
     gatttccaga ttctgggcga caatgaccag aaccccaacc agatcgatgt gatgctggtg       420
     gcggccaaaa aagagacggt caacgattac cttaacgtca tcgatatcgc cgggttgacg       480
     ccggtgatca ttgatgtgga cgcctttgcc cttcaaaaca tttacgaagt caactatgag       540
     gccgaggaga actgcgttgc cctcatcgac atcggggcca acaagacgtc actcaatatt       600
     ctgaagggca gcaaatcggt attcatgcgg gatgtctcct ttgggtgcaa tcagatcaat       660
     catcatatcg ccaccaaaat caactgcagc ctggaagaag cagaagagct gaagctcagc       720
     gacaagcagg agcgcatctc aaccgacgag cttaacagca tcatctcttc ggtggtgtcc       780
     gactggacca ccgaaatccg gcgggccctg gatttctttt attccaccta ctccaacgat       840
     catctcaagt gtatatattt aagcggcggc ggatccaaca tccccgaatt caggcaaatg       900
     ctggcgtccc aaacctcctc ggagctggaa atacttaatc ctttcagcaa cttcgacgtc       960
     aaggacgacc ggctggattc ggcttacctg aaacaaatcg caccccaggc agccatctgc      1020
     atggggattg ccatcagacg ggtggatgac aaatga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page