(data stored in ACNUC7421 zone)

EMBL: CP000859.PE338

CP000859.PE338       Location/Qualifiers
FT   CDS_pept        complement(388370..388780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66148"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY4"
FT                   /protein_id="ABW66148.1"
FT                   /translation="MEALSLYKKAHLVVAAIRVLTYLNNKPPTAEDVEGLLGTSSEEVL
FT                   LVCRKLEKKGIVEAVEGAYGARLFVLDHTAIEEISRDLPTSGMEEEIEKFKKTQQERDK
FT                   KIEEIKAKEEERKRKLFEQLNQGLKQGKPVSE"
     atggaagctc tttcgttata taaaaaagcg cacctggtgg tggcggcaat ccgcgttctg        60
     acctacctga acaacaaacc gccgacggca gaggatgtag agggcctgct tggcacatct       120
     tccgaggagg tgctcctggt ctgccgcaag ctggaaaaaa aggggatcgt ggaggcggtg       180
     gagggggcct acggagcccg gctctttgtg ctggaccata cagcgattga ggagatttcc       240
     agagatcttc ccaccagcgg catggaagag gagatcgaaa agtttaaaaa aacccagcag       300
     gagcgggaca aaaagataga agagatcaag gccaaagaag aggaacgcaa gcgaaaactg       360
     tttgaacagc tcaaccaggg gttgaagcag ggaaaaccgg tatcggaata a                411
//

If you have problems or comments...

PBIL Back to PBIL home page