(data stored in ACNUC7421 zone)

EMBL: CP000859.PE34

CP000859.PE34        Location/Qualifiers
FT   CDS_pept        38838..41114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0034"
FT                   /product="adenylate/guanylate cyclase with TPR repeats"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   CHASE2 domain protein; Tetratricopeptide TPR_2 repeat
FT                   protein; KEGG: sat:SYN_01481 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65844"
FT                   /db_xref="GOA:A8ZRS7"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS7"
FT                   /protein_id="ABW65844.1"
FT                   /translation="MDLLKKSGRAIKTVFSRKPLLLSFCIVVAGALVFMSGISFLDIIE
FT                   LKTIDMRFKLRGDIPPGDRVVLAAIDEKSLKQEGRWVWPRTKIAALVDKLSEKGARVIA
FT                   FDVGFFEPESSEVIQTIGRIQAASKDNALRNKRFDDYLATLKNRSDNDRILVEAIQRSR
FT                   ATVVLGFFFQMNPEDALHITEAEIETHTRQIAGGRYTIERFSSDRAREAWLYRVAAPQS
FT                   NIQAISEATSYAGYFNKLADPDGVVRRMTMVMQFNNTLYAPLSLKAAGAYLDAPLSITV
FT                   EEDYGVASLMLGDLSIPVDERGDLLINYRGPEKTFPHISVTDILNDTVDESLIRDKIVL
FT                   VGATAIGIHDECVTPVAKVFPGPEVHLNVIDAILSEDFLFHPAWAALFDLLVIIGGGML
FT                   LAYVLLKTSALPGGLAMAAMFGGYLWLCQFFFTHMGWILNMVYPLCVFLAIYLFVTSYK
FT                   YLSEEGQKKFIREAFSKYLAPEVVNQLISSPQKLVLGGERREITAFFSDVQGFTSISEK
FT                   LAPEELVELLNDFLTEVTDIILHHKGAVDKFEGDAVIAFFGAPNELPNHPEAACLACID
FT                   IQKRMVELRAKWREQGKPELKVRIGLYSGPAVVGNMGSRNRMDYTMMGDTVNTAARLEG
FT                   VNKIYGTYTMVGQPTYEAAADALFARELDAVTVVGKKTPVAIYEVLGRRGEVDETGVKT
FT                   TEVYAKGLAAYRQRQWDQAVAWFKEALAVTPDDGPSLTMIRRCEAYAENPPPDDWNGAF
FT                   SMMTK"
     atggaccttt tgaaaaaaag cggtcgcgca ataaaaacgg tcttttcacg caagcccctg        60
     ctgctctctt tctgtatcgt ggtggcaggc gcgcttgtct tcatgtccgg catcagcttc       120
     ctggatatca ttgagctgaa aaccattgac atgcggttca agctccgggg ggatatcccg       180
     cccggcgaca gggtggtgct ggcggccatt gatgaaaaaa gcctgaaaca ggagggccgg       240
     tgggtgtggc cccgcaccaa gatagcggcc ctggtggaca agctttccga aaaaggggca       300
     cgggtcatcg cctttgatgt ggggtttttc gaaccggaaa gctccgaggt tatccagacc       360
     atcgggcgca ttcaggcggc gtcaaaggac aacgccctgc ggaacaagcg attcgacgac       420
     tacctggcca cactgaaaaa ccggtcggac aacgaccgga ttctggtgga agccattcag       480
     cgctccaggg caacggtggt gctggggttc ttttttcaga tgaaccccga agacgccctg       540
     catatcaccg aagcggagat tgaaacacac acccggcaaa tcgctggcgg ccgttacacc       600
     attgaacggt tcagttcgga ccgggccagg gaggcgtggc tctatcgggt ggcggccccc       660
     cagtccaaca ttcaggcgat ttcagaggcc acctcctatg ccggatattt caacaagttg       720
     gccgatccgg acggcgtggt gcgccgcatg accatggtga tgcagttcaa caacaccctt       780
     tacgcccctc tctccctgaa ggcggccggc gcctacctgg acgcccccct ctccattacc       840
     gtggaggagg actatggcgt ggcctccctg atgctggggg acctgtccat acccgtggat       900
     gaacggggtg atctgctgat caactaccgg ggaccggaaa agacctttcc ccatatttcg       960
     gtcaccgaca ttctcaacga cacggtggat gaaagcctga tccgggacaa gatcgttctg      1020
     gtgggagcca cggccatcgg cattcacgac gaatgcgtga cgccggtggc caaggtgttt      1080
     cccgggcccg aggtccacct caacgtcatc gacgccatcc tgtctgaaga ttttctgttt      1140
     cacccggcct gggccgcgct gtttgacctt ctggtcatca tcggcggcgg tatgctgctg      1200
     gcttatgtgc tgctgaaaac cagcgccctg cccggcggcc tcgccatggc cgccatgttc      1260
     ggcgggtacc tctggctgtg ccagtttttc ttcacccaca tggggtggat tcttaacatg      1320
     gtctatcccc tgtgcgtgtt tctggcgatc tacctgtttg tgacctctta caaatacctg      1380
     tctgaagagg ggcagaaaaa atttatccgg gaggcctttt ccaagtacct ggcaccggag      1440
     gtggtcaacc agctgatctc ctcgccccag aagctggtac tgggcggcga gcgccgggag      1500
     ataaccgctt ttttctccga tgtccaggga tttaccagca tttccgaaaa gctcgcccct      1560
     gaagagctgg tggagctgct caatgatttt ttaaccgagg tcaccgacat catccttcat      1620
     cacaaagggg ccgtggacaa gttcgaggga gacgcggtca tcgccttttt cggcgccccc      1680
     aacgagcttc ccaaccatcc cgaagcggcc tgcctggcct gtattgatat tcagaaacgg      1740
     atggtcgagc ttcgcgccaa atggcgggag cagggcaaac ccgaactcaa ggtgcgcatc      1800
     ggtctttatt ccggaccggc cgtcgtgggt aacatgggtt ccagaaaccg catggactac      1860
     accatgatgg gcgacaccgt gaacaccgcc gcccggctgg aaggggtcaa caaaatatac      1920
     ggcacttata ccatggtcgg ccagccgacc tacgaggccg cggccgacgc cctgttcgcc      1980
     cgggagctgg atgccgtcac cgtggtgggc aaaaagacgc cggtggccat ttacgaggtc      2040
     ctcggccgcc ggggcgaggt ggacgaaacc ggggtaaaaa ccaccgaggt ctatgccaag      2100
     ggactggcgg cataccgtca gagacaatgg gaccaggccg tcgcctggtt caaggaagcc      2160
     ctggccgtca ccccggatga cggccccagc ctgaccatga tccgccggtg cgaggcctat      2220
     gccgaaaatc cgccccccga tgactggaac ggggcctttt ccatgatgac caagtaa         2277
//

If you have problems or comments...

PBIL Back to PBIL home page