(data stored in ACNUC7421 zone)

EMBL: CP000859.PE342

CP000859.PE342       Location/Qualifiers
FT   CDS_pept        392810..393523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0342"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; FeoA family protein;
FT                   KEGG: gsu:GSU1379 ferric uptake regulation protein Fur"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66152"
FT                   /db_xref="GOA:A8ZSY8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY8"
FT                   /protein_id="ABW66152.1"
FT                   /translation="MFPLKKSAMTKLHDREKSQFKKLFRNEGVDRFEEMMTVLEVFLET
FT                   EGHITANELIDRLTEHGFDFDPSFVRDSLRLLTQFGFAKKLRFDDGKIRYEHCHLGDHH
FT                   DHMLCRKCGKIIEFVDDALETIQAEVAAAHGFHMLGHRMDIYGICADCLKNRIRVIPLS
FT                   RARQGEHLVIEEFTGGTNARMRLMSMGLKTGDPVEVITSDPRGQVVIASGNKRYAIGRG
FT                   LAGKVMARHTDDPAA"
     atgtttcctc tgaaaaagag tgccatgaca aaacttcacg acagggaaaa gtcccagttt        60
     aaaaagctgt tccgcaacga aggtgtggac cggttcgaag agatgatgac cgtgctggag       120
     gtgtttcttg aaaccgaggg tcacatcacc gccaatgaac tgatcgaccg gctcacggaa       180
     cacggctttg atttcgatcc ctcttttgtg cgggactctc tgcgcctgct cacccagttc       240
     gggtttgcca agaagctgcg gtttgacgac ggcaagattc gatacgagca ctgccatctc       300
     ggtgatcacc acgatcacat gctctgccga aagtgcggca agatcatcga attcgtggac       360
     gatgcccttg aaaccattca ggccgaggtg gccgcggccc atggatttca catgctgggc       420
     caccgcatgg acatctacgg catctgcgcg gactgcctga aaaaccgcat tcgggtgatt       480
     cccctgtccc gggccaggca gggcgagcac ctggtgatcg aggagtttac cggcggcacc       540
     aacgcccgca tgcgcctgat gtccatgggc ctgaaaacgg gggacccggt ggaggtgatc       600
     acttccgacc caaggggcca ggtggtgatc gcctcgggta acaagcggta tgccatcggc       660
     cggggccttg ccggcaaggt gatggcccgg cacacggacg accctgccgc ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page