(data stored in ACNUC7421 zone)

EMBL: CP000859.PE344

CP000859.PE344       Location/Qualifiers
FT   CDS_pept        393936..396110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0344"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; Ferrous iron transport B domain protein;
FT                   nucleoside recognition domain protein; KEGG: pgi:PG1294
FT                   ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66154"
FT                   /db_xref="GOA:A8ZSZ0"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ0"
FT                   /protein_id="ABW66154.1"
FT                   /translation="MEKKRFTIALAGNPNSGKTTIFNSLTGTRQKVGNWSGVTVEKKEG
FT                   LIYRRGYEIQLVDLPGTYSLTPFSIEEIVARDFIIDEAPDVVITIIDASNLERSLYLAT
FT                   QVRELDCKVLFALNMADLARAKGMTIDADTLSRLLDVTVAFTVGNKNDGVETLLDLAID
FT                   LAESGKITVPERRVKYNRDAEAAISRIREKIEQAGPPIYNSRWMAIKLLENDQIVRQRL
FT                   VNAYEERSRSILDTVDACRSHLTDIFDDDPEIVMTDERYGFIAGLIKEVVHVSPRARAD
FT                   ISRNIDLVLTNRYLGFPIFIFFIWLMFQATFSLGAYPMTWIESGFALLAAGVDGLLADG
FT                   LVKDLIIDGALAGVGSVAVFLPNILILFFCIALFEDTGYMARAAFLMDRIMHLIGLHGK
FT                   SFIPMLMGFGCSVPAIMATRTLDNRKDRILTILITPFMSCSARLPVYIVLAGTFFPKNA
FT                   GTVIFMIYLLGIVVAMLTGRLFRSTLLKGADAPFVMELPPYRMPMAKSLVIHMWDRARM
FT                   FIRKMGTYIFVGAIVVWALSAFPRNVAYSVDYESQLQKVEAAYTQRIAATENAQALTAI
FT                   GAEKENAITAIRNARSRERSEQVYMGRIGRFVAPVFEPIGIDWRGSVALLTGFVAKEIV
FT                   VSTMGVLYAVADQDGRALGKALRASGMTPLSALSLMVFVLLYIPCIATVTSISREASWR
FT                   WSMFTVAYTTLVAWCASFVVFNAGKIIGIG"
     atggaaaaaa agcgattcac catagcactg gccggcaatc ccaactccgg caaaaccacc        60
     atcttcaaca gccttaccgg cacccgccag aaggtgggca actggtccgg tgtcaccgtt       120
     gaaaaaaaag agggcctgat ttaccggcgg ggttacgaga ttcagcttgt ggatctgccc       180
     ggcacctaca gcctcactcc cttttccatt gaagagatcg ttgcccggga cttcatcatc       240
     gacgaagcgc cggacgtggt catcaccatt attgacgcct ccaacctgga gcgcagcctc       300
     tatcttgcca cccaggtgcg ggagctggac tgcaaggttc tttttgcctt aaacatggcc       360
     gacctggccc gggccaaggg catgaccatt gacgcggaca cgctttcccg gcttctggac       420
     gtgaccgtgg cctttaccgt gggtaataaa aatgacggag tggagaccct tctggacctg       480
     gccatcgacc tggccgagtc gggaaagatc accgtgccgg agcggcgggt gaaatacaac       540
     cgggacgcgg aagcggccat ctcccgaatt cgggaaaaaa tcgaacaggc cggcccaccc       600
     atctacaaca gccgctggat ggccatcaag ctgctggaaa acgaccagat cgttcggcag       660
     cggctggtca atgcttacga agagcgaagc cggtcgatcc tggacacggt agacgcctgc       720
     cgcagccacc tgaccgatat ctttgacgac gacccggaaa ttgtgatgac cgacgagcgg       780
     tacgggttta tcgccggcct gatcaaagag gtggtccatg tcagccccag ggcccgggcc       840
     gatatttccc ggaacattga cctggtactg accaaccggt acctgggatt tccgatattt       900
     atctttttta tatggctgat gtttcaggcc accttttccc tgggggccta ccccatgacc       960
     tggatcgaaa gcgggtttgc cctgctggcc gccggcgtgg acggcctgct ggccgatggc      1020
     ctggtaaagg acctgattat cgacggcgcg ctggccggcg tgggcagcgt ggccgttttc      1080
     ctgcccaaca tcctgattct gtttttctgc atcgccttgt ttgaagacac cgggtacatg      1140
     gcccgggccg cctttcttat ggaccggatc atgcacctga tcggccttca cggaaaatcg      1200
     tttattccca tgctcatggg gttcgggtgc agcgtgccgg ccatcatggc cacccgtacc      1260
     ctggacaacc gcaaggaccg aatcctgacc attctgatca cgcccttcat gtcctgctcg      1320
     gcccggctgc cggtctatat tgtcctggcc ggcacctttt tcccgaaaaa cgcgggcacc      1380
     gttattttca tgatctacct gctgggcatt gtggtggcca tgctcacggg caggcttttc      1440
     cgctccaccc tgcttaaagg ggccgatgcc ccctttgtca tggagctgcc gccctaccgc      1500
     atgcccatgg caaaaagcct ggtgattcac atgtgggacc gggccaggat gtttatcagg      1560
     aagatgggga cctacatttt tgtcggcgcc atcgtggtgt gggccttgtc ggcctttccc      1620
     cggaacgtcg cctattcggt ggattatgag tcacagcttc agaaagttga agcggcctac      1680
     acccaacgga tcgctgccac ggagaatgca caggccctga ccgccattgg cgcggaaaaa      1740
     gaaaacgcca ttaccgcgat caggaacgcc agaagccggg agcgcagcga gcaggtttac      1800
     atgggccgca tcggccggtt tgtggcaccg gtgttcgagc ccatcggtat cgactggcgg      1860
     ggcagcgtgg ccctgctgac cgggtttgtg gccaaggaga tcgttgtcag caccatgggg      1920
     gtgctttatg ccgttgccga ccaggacggc cgtgccctgg gcaaggccct gcgggcctcg      1980
     ggcatgaccc cgctttcggc cctgtcgctc atggtgtttg tgctgctgta tatcccctgt      2040
     attgcaacag ttaccagcat ttcccgggag gcatcgtggc gctggtcaat gttcaccgtg      2100
     gcctatacca cgctggtggc ctggtgcgct tcctttgtgg tgttcaacgc cgggaaaatc      2160
     atcggcatcg gttga                                                       2175
//

If you have problems or comments...

PBIL Back to PBIL home page